OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B7-1 (CD80) (NM_005191) Human Mass Spec Standard

Be the first to review this product
SKU
PH306540
CD80 MS Standard C13 and N15-labeled recombinant protein (NP_005182)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA501576 CD80 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5) 100 ul
$447.00

Other products for "B7-1 or NM_005191"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206540
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC206540 protein sequence
Red=Cloning site Green=Tags(s)

MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK
KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA
DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT
NHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERL
RRESVRPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005182
RefSeq Size 2757
RefSeq ORF 864
Synonyms B7; B7-1; B7.1; BB1; CD28LG; CD28LG1; LAB7
Locus ID 941
UniProt ID P33681
Cytogenetics 3q13.33
Summary The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. provided by RefSeq, Aug 2011
Protein Families Druggable Genome, Transcription Factors, Transmembrane
Protein Pathways Allograft rejection, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Toll-like receptor signaling pathway, Type I diabetes mellitus, Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "B7-1" proteins (4)
SKU Description Size Price
TP306540 Recombinant protein of human CD80 molecule (CD80), 20 µg 20 ug
$867.00
TP700242 Purified recombinant protein of human CD80 molecule (CD80), with C-terminal Fc/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP700243 Purified recombinant protein of human CD80 molecule (CD80), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP724008 Recombinant human B7-1 protein with C-terminal human Fc tag 100 ug
$905.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products