OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B7-1 (CD80) (NM_005191) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306540
Recombinant protein of human CD80 molecule (CD80), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501576 CD80 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "B7-1 or NM_005191"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206540 protein sequence
Red=Cloning site Green=Tags(s)

MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK
KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA
DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT
NHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERL
RRESVRPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005182
Locus ID 941
UniProt ID P33681
Cytogenetics 3q13.33
RefSeq Size 2757
RefSeq ORF 864
Synonyms B7; B7-1; B7.1; BB1; CD28LG; CD28LG1; LAB7
Summary The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. provided by RefSeq, Aug 2011
Protein Categories CD Markers, Cytokines, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transcription Factors, Transmembrane
Protein Pathways Allograft rejection, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Toll-like receptor signaling pathway, Type I diabetes mellitus, Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "B7-1" proteins (4)
SKU Description Size Price
PH306540 CD80 MS Standard C13 and N15-labeled recombinant protein (NP_005182) 10 ug
$3,360.00
TP700242 Purified recombinant protein of human CD80 molecule (CD80), with C-terminal Fc/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP700243 Purified recombinant protein of human CD80 molecule (CD80), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP724008 Recombinant human B7-1 protein with C-terminal human Fc tag 100 ug
$905.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products