OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HEPC (HAMP) (NM_021175) Human Mass Spec Standard

Be the first to review this product
SKU
PH304620
HAMP MS Standard C13 and N15-labeled recombinant protein (NP_066998)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346137 Rabbit Polyclonal Anti-HAMP Antibody
100 ul
$585.00
LY402850 Transient overexpression lysate of hepcidin antimicrobial peptide (HAMP) (as WB positive control) 100 ug
$436.00

Other products for "HEPC or NM_021175"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204620
Predicted MW 9.4 kDa
Protein Sequence
Protein Sequence
>RC204620 protein sequence
Red=Cloning site Green=Tags(s)

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC
GCCHRSKCGMCCKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066998
RefSeq Size 430
RefSeq ORF 252
Synonyms HEPC; HFE2B; LEAP1; PLTR
Locus ID 57817
UniProt ID P81172
Cytogenetics 19q13.12
Summary The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. provided by RefSeq, Oct 2014
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HEPC" proteins (4)
SKU Description Size Price
LC402850 Lyophilized HAMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402850 Transient overexpression lysate of hepcidin antimicrobial peptide (HAMP) (as WB positive control) 100 ug
$436.00
TP304620 Recombinant protein of human hepcidin antimicrobial peptide (HAMP), 20 µg 20 ug
$867.00
TP721154 Purified recombinant protein of Human hepcidin antimicrobial peptide (HAMP) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products