HEPC (HAMP) (NM_021175) Human Tagged ORF Clone

SKU
RC204620
HAMP (Myc-DDK-tagged)-Human hepcidin antimicrobial peptide (HAMP)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HEPC
Synonyms HEPC; HFE2B; LEAP1; PLTR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204620 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACTGAGCTCCCAGATCTGGGCCGCTTGCCTCCTGCTCCTCCTCCTCCTCGCCAGCCTGACCAGTG
GCTCTGTTTTCCCACAACAGACGGGACAACTTGCAGAGCTGCAACCCCAGGACAGAGCTGGAGCCAGGGC
CAGCTGGATGCCCATGTTCCAGAGGCGAAGGAGGCGAGACACCCACTTCCCCATCTGCATTTTCTGCTGC
GGCTGCTGTCATCGATCAAAGTGTGGGATGTGCTGCAAGACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204620 protein sequence
Red=Cloning site Green=Tags(s)

MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC
GCCHRSKCGMCCKT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021175
ORF Size 252 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021175.4
RefSeq Size 430 bp
RefSeq ORF 255 bp
Locus ID 57817
UniProt ID P81172
Cytogenetics 19q13.12
Protein Families Secreted Protein, Transmembrane
MW 9.4 kDa
Summary The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:HEPC (HAMP) (NM_021175) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204620L1 Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), Myc-DDK-tagged 10 ug
$450.00
RC204620L2 Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), mGFP tagged 10 ug
$450.00
RC204620L3 Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), Myc-DDK-tagged 10 ug
$450.00
RC204620L4 Lenti ORF clone of Human hepcidin antimicrobial peptide (HAMP), mGFP tagged 10 ug
$450.00
RG204620 HAMP (tGFP-tagged) - Human hepcidin antimicrobial peptide (HAMP) 10 ug
$350.00
SC112995 HAMP (untagged)-Human hepcidin antimicrobial peptide (HAMP) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.