HEPC (HAMP) Rabbit Polyclonal Antibody

SKU TA346137

Rabbit Polyclonal Anti-HAMP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 9 kDa
• Gene Name: hepcidin antimicrobial peptide
• Database Link:
  NP_066998
  P81172
• Background: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.
• Synonyms: HEPC; HFE2B; LEAP1; PLTR
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 83%

Reference Data

• Protein Families: Secreted Protein, Transmembrane