OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EXOSC3 (NM_016042) Human Mass Spec Standard

Be the first to review this product
SKU
PH300035
EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_057126)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504794 EXOSC3 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6) 100 ul
$447.00
LY414229 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "EXOSC3 or NM_016042"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200035
Predicted MW 29.6 kDa
Protein Sequence
Protein Sequence
>RC200035 protein sequence
Red=Cloning site Green=Tags(s)

MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057126
RefSeq Size 1857
RefSeq ORF 825
Synonyms bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
Locus ID 51010
UniProt ID Q9NQT5
Cytogenetics 9p13.2
Summary This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Jun 2012
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EXOSC3" proteins (7)
SKU Description Size Price
PH318361 EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_001002269) 10 ug
$3,360.00
LC414229 Lyophilized EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424199 Lyophilized EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414229 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424199 Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300035 Recombinant protein of human exosome component 3 (EXOSC3), transcript variant 1, 20 µg 20 ug
$867.00
TP318361 Purified recombinant protein of Homo sapiens exosome component 3 (EXOSC3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products