OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BGLF3.5 (NC_007605) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC101184
Myc-DDK-tagged ORF clone of viral ORF for BGLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401724
  $225.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "BGLF3.5 or NC_007605"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol BGLF3.5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101184 represents NCBI reference of YP_401724 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAATGAGTTCAAGCAAGCGGGATTTGGTGGCACAGCAACTGCGCGCCAGCGTCGAGAAGCGGGCCG
CTGTATCTGCGAGGGACCGCTTCGGCAGAGACCACGCCCTGTTCGAAACCCAATTCACCAGTGCCCGCGG
AGCACTGGAATCCCTGCGACACGCTAGGGAAACCTTCGAGTCCAAACAGCTGATTTCAACCTACCAGCGC
GTGGTTACCGCCACTAAGACACAGTTTCCAAAAATTAATTATAAGCAGCTGGAAAGAGTGGAAGAGCTGC
GCGAACAGGAGTTGGAAGCAAGAGACGAACTCAGACAGGCTCTGGAGCCATTCGAAGAGCACGGCTGCGA
ATATGGATGCGGGGTAGAGCCAGATGAACTGCTCCAGCAATGGAGAGTGGAATGCCTCCCACGGACTCCC
AGTCGCGATCCTGGGCTCTTTGGTGAAGGGGATTGCCAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC101184 representing YP_401724
Red=Cloning sites Green=Tags

MKMSSSKRDLVAQQLRASVEKRAAVSARDRFGRDHALFETQFTSARGALESLRHARETFESKQLISTYQR
VVTATKTQFPKINYKQLERVEELREQELEARDELRQALEPFEEHGCEYGCGVEPDELLQQWRVECLPRTP
SRDPGLFGEGDCH

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_007605
ORF Size 459 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_007605.1, YP_401724
RefSeq ORF 459 bp
Locus ID 3783766
UniProt ID P03211
MW 17.7 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_007605" in other vectors (71)
SKU Description Size Price
VC101093 Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 4], codon optimized for human cell expression, YP_401631 10 ug
$686.00
VC101094 Myc-DDK-tagged ORF clone of viral ORF for LMP-2B [Human herpesvirus 4], codon optimized for human cell expression, YP_401632 10 ug
$686.00
VC101095 Myc-DDK-tagged ORF clone of viral ORF for BNRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401633 10 ug
$1,262.00
VC101096 Myc-DDK-tagged ORF clone of viral ORF for BCRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401634 10 ug
$330.00
VC101108 Myc-DDK-tagged ORF clone of viral ORF for BHRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401646 10 ug
$289.00 $300.00
VC101109 Myc-DDK-tagged ORF clone of viral ORF for BFLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401647 10 ug
$330.00
VC101110 Myc-DDK-tagged ORF clone of viral ORF for BFLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401648 10 ug
$538.00
VC101111 Myc-DDK-tagged ORF clone of viral ORF for BFRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401649 10 ug
$503.00
VC101112 Myc-DDK-tagged ORF clone of viral ORF for BFRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401650 10 ug
$825.00
VC101116 Myc-DDK-tagged ORF clone of viral ORF for BORF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401654 10 ug
$503.00
VC101117 Myc-DDK-tagged ORF clone of viral ORF for BORF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401655 10 ug
$832.00
VC101118 Myc-DDK-tagged ORF clone of viral ORF for BaRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401656 10 ug
$330.00
VC101119 Myc-DDK-tagged ORF clone of viral ORF for BMRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401657 10 ug
$686.00
VC101120 Myc-DDK-tagged ORF clone of viral ORF for BMRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401658 10 ug
$503.00
VC101121 Myc-DDK-tagged ORF clone of viral ORF for BSLF2/BMLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401659 10 ug
$289.00 $503.00
VC101122 Myc-DDK-tagged ORF clone of viral ORF for BSLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401662 10 ug
$880.00
VC101123 Myc-DDK-tagged ORF clone of viral ORF for BSRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401663 10 ug
$330.00
VC101124 Myc-DDK-tagged ORF clone of viral ORF for BLLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401664 10 ug
$330.00
VC101125 Myc-DDK-tagged ORF clone of viral ORF for BLRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401665 10 ug
$165.00
VC101126 Myc-DDK-tagged ORF clone of viral ORF for BLRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401666 10 ug
$165.00
VC101128 Myc-DDK-tagged ORF clone of viral ORF for BLLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401668 10 ug
$165.00
VC101132 Myc-DDK-tagged ORF clone of viral ORF for BZLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401672 10 ug
$330.00
VC101133 Myc-DDK-tagged ORF clone of viral ORF for BZLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401673 10 ug
$450.00
VC101134 Myc-DDK-tagged ORF clone of viral ORF for BRLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401674 10 ug
$619.00
VC101135 Myc-DDK-tagged ORF clone of viral ORF for BRRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401675 10 ug
$330.00
VC101136 Myc-DDK-tagged ORF clone of viral ORF for BRRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401676 10 ug
$550.00
VC101138 Myc-DDK-tagged ORF clone of viral ORF for BKRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401678 10 ug
$165.00
VC101139 Myc-DDK-tagged ORF clone of viral ORF for BKRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401679. Note: ORF is codon optimized 10 ug
$289.00 $330.00
VC101140 Myc-DDK-tagged ORF clone of viral ORF for BKRF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401680 10 ug
$330.00
VC101141 Myc-DDK-tagged ORF clone of viral ORF for BBLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401681 10 ug
$815.00
VC101142 Myc-DDK-tagged ORF clone of viral ORF for BBRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401682 10 ug
$628.00
VC101143 Myc-DDK-tagged ORF clone of viral ORF for BBRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401683 10 ug
$330.00
VC101144 Myc-DDK-tagged ORF clone of viral ORF for BBLF2/BBLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401684 10 ug
$714.00
VC101145 Myc-DDK-tagged ORF clone of viral ORF for BBRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401685 10 ug
$503.00
VC101146 Myc-DDK-tagged ORF clone of viral ORF for BBLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401686 10 ug
$165.00
VC101147 Myc-DDK-tagged ORF clone of viral ORF for BGLF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401687 10 ug
$503.00
VC101148 Myc-DDK-tagged ORF clone of viral ORF for BGLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401688 10 ug
$503.00
VC101149 Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401689 10 ug
$330.00
VC101150 Myc-DDK-tagged ORF clone of viral ORF for BGRF1/BDRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401690 10 ug
$695.00
VC101151 Myc-DDK-tagged ORF clone of viral ORF for BGLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401691 10 ug
$503.00
VC101152 Myc-DDK-tagged ORF clone of viral ORF for BGLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401692 10 ug
$519.00
VC101153 Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401693 10 ug
$330.00
VC101154 Myc-DDK-tagged ORF clone of viral ORF for BDLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401694 10 ug
$330.00
VC101155 Myc-DDK-tagged ORF clone of viral ORF for BDLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401695 10 ug
$503.00
VC101156 Myc-DDK-tagged ORF clone of viral ORF for BDLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401696 10 ug
$330.00
VC101157 Myc-DDK-tagged ORF clone of viral ORF for BcLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401697 10 ug
$1,299.00
VC101158 Myc-DDK-tagged ORF clone of viral ORF for BcRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401698 10 ug
$1,030.00
VC101159 Myc-DDK-tagged ORF clone of viral ORF for BTRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401699 10 ug
$503.00
VC101160 Myc-DDK-tagged ORF clone of viral ORF for BXLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401700 10 ug
$711.00
VC101161 Myc-DDK-tagged ORF clone of viral ORF for BXLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401701 10 ug
$621.00
VC101162 Myc-DDK-tagged ORF clone of viral ORF for BXRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401702 10 ug
$330.00
VC101163 Myc-DDK-tagged ORF clone of viral ORF for BVRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401703 10 ug
$584.00
VC101164 Myc-DDK-tagged ORF clone of viral ORF for BVRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401704 10 ug
$619.00
VC101165 Myc-DDK-tagged ORF clone of viral ORF for BdRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401705 10 ug
$686.00
VC101166 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein [Human herpesvirus 4], codon optimized for human cell expression, YP_401706 10 ug
$330.00
VC101168 Myc-DDK-tagged ORF clone of viral ORF for LF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401708 10 ug
$503.00
VC101169 Myc-DDK-tagged ORF clone of viral ORF for LF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401709 10 ug
$503.00
VC101170 Myc-DDK-tagged ORF clone of viral ORF for RPMS1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401710 10 ug
$165.00
VC101171 Myc-DDK-tagged ORF clone of viral ORF for BILF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401711 10 ug
$450.00
VC101172 Myc-DDK-tagged ORF clone of viral ORF for BALF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401712 10 ug
$972.00
VC101173 Myc-DDK-tagged ORF clone of viral ORF for BALF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401713 10 ug
$863.00
VC101174 Myc-DDK-tagged ORF clone of viral ORF for A73 [Human herpesvirus 4], codon optimized for human cell expression, YP_401714 10 ug
$165.00
VC101175 Myc-DDK-tagged ORF clone of viral ORF for BALF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401715 10 ug
$690.00
VC101177 Myc-DDK-tagged ORF clone of viral ORF for BALF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401717 10 ug
$1,080.00
VC101178 Myc-DDK-tagged ORF clone of viral ORF for BALF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401718 10 ug
$330.00
VC101179 Myc-DDK-tagged ORF clone of viral ORF for BARF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401719 10 ug
$330.00
VC101180 Myc-DDK-tagged ORF clone of viral ORF for BNLF2b [Human herpesvirus 4], codon optimized for human cell expression, YP_401720 10 ug
$165.00
VC101181 Myc-DDK-tagged ORF clone of viral ORF for BNLF2a [Human herpesvirus 4], codon optimized for human cell expression, YP_401721 10 ug
$165.00
VC101183 Myc-DDK-tagged ORF clone of viral ORF for BFRF1A [Human herpesvirus 4], codon optimized for human cell expression, YP_401728 10 ug
$165.00
VC101185 Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401725 10 ug
$240.00
VC101186 Myc-DDK-tagged ORF clone of viral ORF for BVLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401726 10 ug
$330.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products