OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

US10 (NC_001798) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100936
Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 2], codon optimized for human cell expression, NP_044541
  $330.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "US10 or NC_001798"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol US10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100936 represents NCBI reference of NP_044541 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTAGGAGGCGAGGCAACGTGGAAATTAGAGTCTATTACGAATCAGTGCGCCCTTCACGATCTAGGA
GTCACTTGAAGCCGTCTGACCACCAAGAATTCCCTGGTCACCACGTGAGTCCCGGATCTCCCGGCTTTCC
CGAAAGTCCGGGGAACAGGGAATTTCACGACCTCCCAGAAAATCCAGGTAGCAGAGCCTATCCTGGCACC
CGCGACCCCCATGACCCCCATGGTTGTCCTGGATCACTCGACCCACACGGCAACCCAGCCCAACCCGCAG
GCCTGCCATCTCCTGTACCTTACGCACCCCTGGGAAGCCCCGACCCTTCTTCACCCCGGCAGCGCACCTA
CGTCCTTCCACGAGTCGGAATACATAATGCACCAGCAAGTGACACCAGAGCGCCCAAGAGAGCCAACAGT
AGACACCGGGCGGACCGACCACCGGAGTCCCCCGGATCCGAGCTGTACCCCCTCAACGCACAGGCACTGG
CTCATCTGCAGATGCTGCCGGCCGATCATAGAGCTTTTTTCAGAACTGTCATCGAGGTGAGCCGCTTGTG
CGCTCTTAACACACACGACCCCCCTCCTCCTCTTGCTGGCGCCCGCGTCGGGCAGGAGGCACAGTTGGTA
CACACCCAGTGGCTCCGAGCCAACAGGGAATCTAGCCCCCTGTGGCCATGGCGCACCGCCGCAATGAATT
TCATCGCTGCCGCTGCCCCTTGTGTGCAAACGCACAGACACATGCATGATCTTCTTATGGCATGTGCCTT
TTGGTGTTGTCTTGCACACGCATCAACATGCTCATACGCCGGATTGTATAGTGCCCATTGTCAGCATTTG
TTCAGAGCCTTCGGCTGCGGCCCTCCCGTGCTCACAACGTCCCGCGGCCAGGGCGGATGGTGCAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100936 representing NP_044541
Red=Cloning sites Green=Tags

MIRRRGNVEIRVYYESVRPSRSRSHLKPSDHQEFPGHHVSPGSPGFPESPGNREFHDLPENPGSRAYPGT
RDPHDPHGCPGSLDPHGNPAQPAGLPSPVPYAPLGSPDPSSPRQRTYVLPRVGIHNAPASDTRAPKRANS
RHRADRPPESPGSELYPLNAQALAHLQMLPADHRAFFRTVIEVSRLCALNTHDPPPPLAGARVGQEAQLV
HTQWLRANRESSPLWPWRTAAMNFIAAAAPCVQTHRHMHDLLMACAFWCCLAHASTCSYAGLYSAHCQHL
FRAFGCGPPVLTTSRGQGGWCN

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_001798
ORF Size 906 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001798.1, NP_044541
RefSeq ORF 906 bp
Locus ID 1487351
MW 33.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_001798" in other vectors (56)
SKU Description Size Price
VC100865 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 2], codon optimized for human cell expression, NP_044470 10 ug
$330.00
VC100866 Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 2], codon optimized for human cell expression, NP_044471 10 ug
$503.00
VC100867 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 2], codon optimized for human cell expression, NP_044472 10 ug
$330.00
VC100868 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 2], codon optimized for human cell expression, NP_044473 10 ug
$330.00
VC100869 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044474 10 ug
$887.00
VC100870 Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044475 10 ug
$683.00
VC100871 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 2], codon optimized for human cell expression, NP_044476 10 ug
$330.00
VC100873 Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 2], codon optimized for human cell expression, NP_044478 10 ug
$873.00
VC100874 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 2], codon optimized for human cell expression, NP_044479 10 ug
$732.00
VC100875 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044480 10 ug
$165.00
VC100877 Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 2], codon optimized for human cell expression, NP_044482 10 ug
$530.00
VC100878 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 2], codon optimized for human cell expression, NP_044483 10 ug
$330.00
VC100879 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 2], codon optimized for human cell expression, NP_044484 10 ug
$739.00
VC100880 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 2], codon optimized for human cell expression, NP_044485 10 ug
$503.00
VC100882 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 2], codon optimized for human cell expression, NP_044487 10 ug
$330.00
VC100883 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044488 10 ug
$1,293.00
VC100884 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 2], codon optimized for human cell expression, NP_044489 10 ug
$330.00
VC100885 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 2], codon optimized for human cell expression, NP_044490 10 ug
$545.00
VC100886 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 2], codon optimized for human cell expression, NP_044491 10 ug
$844.00
VC100887 Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 2], codon optimized for human cell expression, NP_044492 10 ug
$503.00
VC100888 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 2], codon optimized for human cell expression, NP_044493 10 ug
$330.00
VC100889 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 2], codon optimized for human cell expression, NP_044494 10 ug
$599.00
VC100892 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 2], codon optimized for human cell expression, NP_044497 10 ug
$910.00
VC100894 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044499 10 ug
$1,145.00
VC100895 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044500 10 ug
$1,187.00
VC100896 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044501 10 ug
$330.00
VC100898 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 2], codon optimized for human cell expression, NP_044503 10 ug
$165.00
VC100899 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044504 10 ug
$330.00
VC100900 Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044505 10 ug
$165.00
VC100902 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 2], codon optimized for human cell expression, NP_044507 10 ug
$1,067.00
VC100903 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 2], codon optimized for human cell expression, NP_044508 10 ug
$503.00
VC100904 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 2], codon optimized for human cell expression, NP_044509 10 ug
$1,093.00
VC100905 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 2], codon optimized for human cell expression, NP_044510 10 ug
$503.00
VC100906 Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044511 10 ug
$503.00
VC100907 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044512 10 ug
$503.00
VC100909 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein C [Human herpesvirus 2], codon optimized for human cell expression, NP_044514 10 ug
$503.00
VC100910 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL45 [Human herpesvirus 2], codon optimized for human cell expression, NP_044515 10 ug
$330.00
VC100911 Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 2], codon optimized for human cell expression, NP_044516 10 ug
$727.00
VC100913 Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 2], codon optimized for human cell expression, NP_044518 10 ug
$686.00
VC100915 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 2], codon optimized for human cell expression, NP_044520 10 ug
$165.00
VC100916 Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 2], codon optimized for human cell expression, NP_044521 10 ug
$503.00
VC100917 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 2], codon optimized for human cell expression, NP_044522 10 ug
$330.00
VC100918 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044523 10 ug
$1,021.00
VC100919 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 2], codon optimized for human cell expression, NP_044524 10 ug
$503.00
VC100921 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 2], codon optimized for human cell expression, NP_044526 10 ug
$330.00
VC100922 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 2], codon optimized for human cell expression, NP_044527 10 ug
$330.00
VC100926 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 2], codon optimized for human cell expression, NP_044531 10 ug
$503.00
VC100927 Myc-DDK-tagged ORF clone of viral ORF for virion protein US2 [Human herpesvirus 2], codon optimized for human cell expression, NP_044532 10 ug
$330.00
VC100928 Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 2], codon optimized for human cell expression, NP_044533 10 ug
$503.00
VC100930 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein J [Human herpesvirus 2], codon optimized for human cell expression, NP_044535 10 ug
$165.00
VC100931 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein D [Human herpesvirus 2], codon optimized for human cell expression, NP_044536 10 ug
$503.00
VC100932 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 2], codon optimized for human cell expression, NP_044537 10 ug
$503.00
VC100933 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 2], codon optimized for human cell expression, NP_044538 10 ug
$558.00
VC100934 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US8A [Human herpesvirus 2], codon optimized for human cell expression, NP_044539 10 ug
$165.00
VC100935 Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 2], codon optimized for human cell expression, NP_044540 10 ug
$165.00
VC100938 Myc-DDK-tagged ORF clone of viral ORF for TAP transporter inhibitor ICP47 [Human herpesvirus 2], codon optimized for human cell expression, NP_044543 10 ug
$165.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products