OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HCoV-229E 4B Gene Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100565
Myc-DDK-tagged ORF clone for 4b protein [Human coronavirus 229E], codon optimized for human cell expression, NP_073553
  $165.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "4b or NC_002645"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol 4b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100565 represents NCBI reference of NP_073553 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGGAAAGTGCTGGTTCCTTGAAAACAAAGCCCTGAAGCCGTTCGTGTGCTTTTACGGGGGCGACC
AATTTCTGTACATTGGGGACAGAATCGTGTCTTACTTCAGCACTAATGACCTGTACGTGGCCCTGAGAGG
GCGCATTGATAAAGACCTCAGCCTGTCAAGAAAGGTCGAGCTGTACAATGGTGAGTGCGTATACCTGTTC
TGCGAACACCCTGCCGTTGGAATTGTAAACACCGATTTCAAGCTCGAGATCCAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100565 representing NP_073553
Red=Cloning sites Green=Tags

MQGKCWFLENKALKPFVCFYGGDQFLYIGDRIVSYFSTNDLYVALRGRIDKDLSLSRKVELYNGECVYLF
CEHPAVGIVNTDFKLEIH

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_002645
ORF Size 264 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_002645.1, NP_073553
RefSeq ORF 264 bp
Locus ID 918760
MW 10.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_002645" in other vectors (5)
SKU Description Size Price
VC100563 Myc-DDK-tagged ORF clone for surface glycoprotein [Human coronavirus 229E], codon optimized for human cell expression, NP_073551 10 ug
$1,123.00
VC100564 Myc-DDK-tagged ORF clone for 4a protein [Human coronavirus 229E], codon optimized for human cell expression, NP_073552 10 ug
$165.00
VC100566 Myc-DDK-tagged ORF clone for envelope protein [Human coronavirus 229E], codon optimized for human cell expression, NP_073554 10 ug
$165.00
VC100567 Myc-DDK-tagged ORF clone for membrane protein [Human coronavirus 229E], codon optimized for human cell expression, NP_073555 10 ug
$289.00 $300.00
VC100568 Myc-DDK-tagged ORF clone for nucleocapsid protein [Human coronavirus 229E], codon optimized for human cell expression, NP_073556 10 ug
$686.00

file-alt Citations

Vpr counteracts the restriction of LAPTM5 to promote HIV-1 infection in macrophages
Zhao, Wang, Xu et al
Nat Commun (2021) 12 (1), 3691 DOI: 10.1038/s41467-021-24087-8
Cited by 44
AI Summary: OriGene contributed LAPTM5, 4A, and 4B expression vectors, which were used in this study to investigate how Vpr counteracts LAPTM5-mediated restriction of HIV-1 infection in macrophages.
Snippet: MG132, chloroquine (CLQ), and bafilomycin A1 (BFLA) were purchased from Sigma Aldrich. Plasmids. The LAPTM5, 4A, and 4B expression vectors were purchased from OriGene, or their open reading frames were de novo cloned into pCMV-3Tag-2A (Addgene) vector
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products