OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNA binding protein (NC_012959) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100163
Myc-DDK-tagged ORF clone of viral ORF for DNA binding protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038614
  $503.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "DNA binding protein or NC_012959"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol DNA binding protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100163 represents NCBI reference of YP_003038614 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGGGGTAGTCAGGACGTTAGAAGGTTCATGGACAGGGAAGCAACACCACCACGGGGACACGGGA
GCGCCAGGTATCCCCCTGAACAGGAGAGATCCCCATCACCACCACTCCCACCTCTCCCTACTAAACGGCG
CAAGTATCAAAGGGTGGGCTCTGGATCTTCCGAGGAGGACGTAGTGCCCCTGGACAGTCCCCCCAAAAAG
AAACAGCCTCGGAAGACCAAGCATGTGACGAAAGTGAACCCCGATGAAGAGATGCCCCAGGAGGACGCTG
TGATCGTTGGGGTCGGTTTTAGCCAGCCTCCCGTGCTGTTGAAGGAAGGCAAGGATGGCAAGCGGATAGT
CCAGCCCGCCACCCCCGGCATTCTGAATGTTTGTAATCCACTGTCCTTGCCCCTGGTGTCAAGCTGGGAA
AAGGGTATGGACACAATGAATGTGCTCATGGAACGATATAGAGTGGATTCCGGGCTGAGGGACGCCTATA
AGCTTATGCCGGAACAGACAGAGATTTTTCAGAAGATGTGTCAGACATGGATAAACGAAGAGGCACGGGG
AATGCAGCTGACGTTCACCACCCAAAAAAGTTTCTCAACAGTTATGGGGCGGCTGCTCCAAGGCTATATT
TTTTCTCACTCAGGTATCGCCCATAAGAACTGGGAGTGCACCGGTAGCGCTCTGTGGGATCACGGATGCG
CCGAGGTGGAGGGCCAGCTGAAGTGTCTCCATGGCACCGTGATGATCCATAAAGATCACGTAGTGGAAAT
GGACGTTACAAGTGAAAATGGGCAGCGCGCCCTCAAGGAACAGCCCTCCAAGGCTAAGGTGACTCAGAAC
CGCTGGGGGAGGTCAGTGGTCCAGCTCACCTCCCACGACGCCCGCTGCTGTGTGCAGGATGCAGGGTGCG
GTAACAATCAGTTTTCCGGTAAAAGCTGCGGGCTGTTCTTCTCCGAAGGCGCTAAAGCACAACAGGCTTT
TAAACAGATCATGGCCTTCATTAAGGCGCTGTACCCAAATATGCAGCGCGGCGCCGGCATGATGCTCATG
CCTGTGCATTGTGAGTGCAACCATAAGCCTCACAGCGTGCCCTTCCTTGGAAGACAGCTGTGCAAGATGA
CCCCCTTCGGGCTTAGCAACGCAGAAGACCTTGACAAAGACCAGATAAGTGACAAATCCGTGCTGGCATC
CGTGAAGTATCCCTCCCTGATGGTCTTCCAGTGCTGCAACCCGGTCTACCGCAATTCCCGGGCTCAAAGT
ACGGGGCCTAATTGCGACTTCAAGATCAGCGCCCCCGACATGCTCGGGGCTCTGCAGATGAGCCGGAGAA
TGTGGAGCGAGACCTTCCCGGAAATCGCGGTTCCTAAGCTCGTTATTCCCGAATTCAAGTGGCAACCAAA
ATACCAGTACAGGAACGTCGCCCTCCCCTCCGCTGCCCACAACGATGAGCGGGAGAATCCTTTCGATTTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100163 representing YP_003038614
Red=Cloning sites Green=Tags

MAGGSQDVRRFMDREATPPRGHGSARYPPEQERSPSPPLPPLPTKRRKYQRVGSGSSEEDVVPLDSPPKK
KQPRKTKHVTKVNPDEEMPQEDAVIVGVGFSQPPVLLKEGKDGKRIVQPATPGILNVCNPLSLPLVSSWE
KGMDTMNVLMERYRVDSGLRDAYKLMPEQTEIFQKMCQTWINEEARGMQLTFTTQKSFSTVMGRLLQGYI
FSHSGIAHKNWECTGSALWDHGCAEVEGQLKCLHGTVMIHKDHVVEMDVTSENGQRALKEQPSKAKVTQN
RWGRSVVQLTSHDARCCVQDAGCGNNQFSGKSCGLFFSEGAKAQQAFKQIMAFIKALYPNMQRGAGMMLM
PVHCECNHKPHSVPFLGRQLCKMTPFGLSNAEDLDKDQISDKSVLASVKYPSLMVFQCCNPVYRNSRAQS
TGPNCDFKISAPDMLGALQMSRRMWSETFPEIAVPKLVIPEFKWQPKYQYRNVALPSAAHNDERENPFDF

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_012959
ORF Size 1470 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_012959.1, YP_003038614
RefSeq ORF 1470 bp
MW 54.9 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_012959" in other vectors (35)
SKU Description Size Price
VC100146 Myc-DDK-tagged ORF clone of viral ORF for early E1A 13s [Human adenovirus 54], codon optimized for human cell expression, YP_003038597 10 ug
$289.00 $330.00
VC100147 Myc-DDK-tagged ORF clone of viral ORF for Early E1A 12s [Human adenovirus 54], codon optimized for human cell expression, YP_003038598 10 ug
$330.00
VC100148 Myc-DDK-tagged ORF clone of viral ORF for E1B 211 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038599 10 ug
$330.00
VC100149 Myc-DDK-tagged ORF clone of viral ORF for E1B 55 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038600 10 ug
$503.00
VC100150 Myc-DDK-tagged ORF clone of viral ORF for pIX [Human adenovirus 54], codon optimized for human cell expression, YP_003038601 10 ug
$165.00
VC100151 Myc-DDK-tagged ORF clone of viral ORF for pIVa2 [Human adenovirus 54], codon optimized for human cell expression, YP_003038602 10 ug
$503.00
VC100152 Myc-DDK-tagged ORF clone of viral ORF for polymerase [Human adenovirus 54], codon optimized for human cell expression, YP_003038603 10 ug
$1,045.00
VC100153 Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 54], codon optimized for human cell expression, YP_003038604 10 ug
$649.00
VC100154 Myc-DDK-tagged ORF clone of viral ORF for 52/55K [Human adenovirus 54], codon optimized for human cell expression, YP_003038605 10 ug
$503.00
VC100155 Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 54], codon optimized for human cell expression, YP_003038606 10 ug
$577.00
VC100156 Myc-DDK-tagged ORF clone of viral ORF for penton [Human adenovirus 54], codon optimized for human cell expression, YP_003038607 10 ug
$528.00
VC100157 Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 54], codon optimized for human cell expression, YP_003038608 10 ug
$330.00
VC100158 Myc-DDK-tagged ORF clone of viral ORF for pV [Human adenovirus 54], codon optimized for human cell expression, YP_003038609 10 ug
$330.00
VC100159 Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 54], codon optimized for human cell expression, YP_003038610 10 ug
$165.00
VC100160 Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 54], codon optimized for human cell expression, YP_003038611 10 ug
$330.00
VC100161 Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 54], codon optimized for human cell expression, YP_003038612 10 ug
$960.00
VC100162 Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 54], codon optimized for human cell expression, YP_003038613 10 ug
$330.00
VC100164 Myc-DDK-tagged ORF clone of viral ORF for 802 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038615 10 ug
$717.00
VC100165 Myc-DDK-tagged ORF clone of viral ORF for 145 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038616 10 ug
$165.00
VC100166 Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 54], codon optimized for human cell expression, YP_003038617 10 ug
$330.00
VC100167 Myc-DDK-tagged ORF clone of viral ORF for 122 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038618 10 ug
$165.00
VC100168 Myc-DDK-tagged ORF clone of viral ORF for 209 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038619 10 ug
$330.00
VC100169 Myc-DDK-tagged ORF clone of viral ORF for 176 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038620 10 ug
$165.00
VC100170 Myc-DDK-tagged ORF clone of viral ORF for 445 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038621 10 ug
$503.00
VC100171 Myc-DDK-tagged ORF clone of viral ORF for 293 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038622 10 ug
$330.00
VC100172 Myc-DDK-tagged ORF clone of viral ORF for 105 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038623 10 ug
$165.00
VC100173 Myc-DDK-tagged ORF clone of viral ORF for 142 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038624 10 ug
$165.00
VC100174 Myc-DDK-tagged ORF clone of viral ORF for 147 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038625 10 ug
$165.00
VC100175 Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 54], codon optimized for human cell expression, YP_003038626 10 ug
$503.00
VC100176 Myc-DDK-tagged ORF clone of viral ORF for 34 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038627 10 ug
$330.00
VC100177 Myc-DDK-tagged ORF clone of viral ORF for 85 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038628 10 ug
$165.00
VC100178 Myc-DDK-tagged ORF clone of viral ORF for 141 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038629 10 ug
$165.00
VC100179 Myc-DDK-tagged ORF clone of viral ORF for 136 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038630 10 ug
$165.00
VC100180 Myc-DDK-tagged ORF clone of viral ORF for 145 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038631 10 ug
$165.00
VC100181 Myc-DDK-tagged ORF clone of viral ORF for 73 kDa protein [Human adenovirus 54], codon optimized for human cell expression, YP_003038632 10 ug
$165.00

file-alt Citations

Identification of Human Islet Amyloid Polypeptide as a BACE2 Substrate
Rulifson, Cao, Miao et al
PLoS ONE (2016) 11 (2), e0147254 DOI: 10.1371/journal.pone.0147254
Cited by 39
AI Summary: OriGene products contributed to this study by providing plasmid DNA and an anti-DDK monoclonal antibody, which were used for the detection and analysis of human IAPP, BACE2, and BACE1 proteins.
Snippet: Cell assays and protein analysis. Plasmid DNA was purchased from Origene (Rockville, MD). ... Human IAPP, BACE2 and BACE1 proteins were detected using an anti-DDK monoclonal antibody (Origene). Also used were anti-hAPP 6E10 (Covance) and β-actin (Sigma ... Cite SaveSaving
FigureFigureFigure
WB
Differential expression of endoplasmic reticulum stress-response proteins in different renal tubule subtypes of OVE26 diabetic mice
Barati, Powell, Kechavarzi et al
Cell Stress Chaperones (2015)
Cited by 15
AI Summary: OriGene's CHOP DNA plasmid was used to overexpress CHOP in cultured proximal tubule cells, enabling the study of CHOP's role in fibronectin expression and ER stress response in diabetic mouse kidney tubules.
Snippet: For overexpression of CHOP, cells were grown to 85 % confluence and subject to transfection with 2 μg CHOP DNA (Origene, Rockville, MD) or vector control for 24 h, using Lipofectamine 2000. ER stress markers in different renal tubules of type 1 diabetic mice Page ... Cite SaveSaving
Sphingosine 1-phosphate induces filopodia formation through S1PR2 activation of ERM proteins
Gandy, Canals, Adada et al
Biochem. J. (2013) 449 (3), 661-72 DOI: 10.1042/BJ20120213
Cited by 2
AI Summary: OriGene’s S1PR2-GFP plasmid DNA was used in this study to investigate the role of S1PR2 in mediating sphingosine 1-phosphate-induced phosphorylation of ERM proteins and filopodia formation.
Snippet: S1PR2-GFP (green fluoresent protein) plasmid DNA was purchased from Origene. SKX ... transillumination. A 170-bp band indicated the WT (wild-type) S1PR2 allele and a band at 220 bp represented a knockout or NEO allele. Immunoblotting.
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products