OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

E3 RID-beta (AC_000008) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100136
Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus 5], codon optimized for human cell expression, AP_000223
  $225.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "E3 RID-beta or AC_000008"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol E3 RID-beta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100136 represents NCBI reference of AP_000223 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTTACTGTAACCTTTCTGCTCATTATCTGCACTCTCTCAGCGTTTTGTTCTCCTACTAGCAAGC
CCCAGAGGCACATCTCATGCCGCTTCACGCGCATTTGGAATATTCCATCTTGTTATAACGAAAAATCTGA
TCTCAGTGAGGCATGGCTGTACGCAATCATCTCTGTCATGGTGTTTTGCTCCACGATACTGGCGCTCGCT
ATTTATCCTTATCTGGATATCGGATGGAAAAGAATCGACGCTATGAACCATCCTACTTTCCCCGCCCCAG
CAATGCTTCCGCTTCAGCAAGTCGTTGCCGGCGGGTTTGTCCCCGCTAATCAGCCACGCCCAACTTCCCC
CACCCCTACCGAAATCTCTTATTTTAACCTCACAGGGGGCGATGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100136 representing AP_000223
Red=Cloning sites Green=Tags

MKFTVTFLLIICTLSAFCSPTSKPQRHISCRFTRIWNIPSCYNEKSDLSEAWLYAIISVMVFCSTILALA
IYPYLDIGWKRIDAMNHPTFPAPAMLPLQQVVAGGFVPANQPRPTSPTPTEISYFNLTGGDD

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN AC_000008
ORF Size 396 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq AC_000008.1, AP_000223
RefSeq ORF 396 bp
MW 14.8 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"AC_000008" in other vectors (35)
SKU Description Size Price
VC100110 Myc-DDK-tagged ORF clone of viral ORF for E1A [Human adenovirus 5], codon optimized for human cell expression, AP_000197 10 ug
$450.00
VC100111 Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus 5], codon optimized for human cell expression, AP_000198 10 ug
$289.00 $300.00
VC100112 Myc-DDK-tagged ORF clone of viral ORF for E1B 55K [Human adenovirus 5], codon optimized for human cell expression, AP_000199 10 ug
$732.00
VC100113 Myc-DDK-tagged ORF clone of viral ORF for IX [Human adenovirus 5], codon optimized for human cell expression, AP_000200 10 ug
$289.00
VC100114 Myc-DDK-tagged ORF clone of viral ORF for IVa2 [Human adenovirus 5], codon optimized for human cell expression, AP_000201 10 ug
$289.00 $457.00
VC100115 Myc-DDK-tagged ORF clone of viral ORF for pol [Human adenovirus 5], codon optimized for human cell expression, AP_000202 10 ug
$589.00 $1,043.00
VC100116 Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 5], codon optimized for human cell expression, AP_000203 10 ug
$589.00 $676.00
VC100117 Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus 5], codon optimized for human cell expression, AP_000204 10 ug
$289.00 $457.00
VC100118 Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 5], codon optimized for human cell expression, AP_000205 10 ug
$289.00 $545.00
VC100119 Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus 5], codon optimized for human cell expression, AP_000206 10 ug
$289.00 $585.00
VC100120 Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 5], codon optimized for human cell expression, AP_000207 10 ug
$289.00 $300.00
VC100121 Myc-DDK-tagged ORF clone of viral ORF for V [Human adenovirus 5], codon optimized for human cell expression, AP_000208 10 ug
$289.00 $457.00
VC100122 Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 5], codon optimized for human cell expression, AP_000209 10 ug
$289.00
VC100123 Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 5], codon optimized for human cell expression, AP_000210 10 ug
$289.00 $300.00
VC100124 Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 5], codon optimized for human cell expression, AP_000211 10 ug
$589.00 $959.00
VC100125 Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 5], codon optimized for human cell expression, AP_000212 10 ug
$289.00 $300.00
VC100126 Myc-DDK-tagged ORF clone of viral ORF for DBP [Human adenovirus 5], codon optimized for human cell expression, AP_000213 10 ug
$289.00 $492.00
VC100127 Myc-DDK-tagged ORF clone of viral ORF for 100K [Human adenovirus 5], codon optimized for human cell expression, AP_000214 10 ug
$589.00 $813.00
VC100128 Myc-DDK-tagged ORF clone of viral ORF for 33K [Human adenovirus 5], codon optimized for human cell expression, AP_000215 10 ug
$289.00 $300.00
VC100129 Myc-DDK-tagged ORF clone of viral ORF for 22K [Human adenovirus 5], codon optimized for human cell expression, AP_000216 10 ug
$289.00 $300.00
VC100130 Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 5], codon optimized for human cell expression, AP_000217 10 ug
$289.00 $300.00
VC100131 Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus 5], codon optimized for human cell expression, AP_000218 10 ug
$289.00
VC100132 Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha0 [Human adenovirus 5], codon optimized for human cell expression, AP_000219 10 ug
$289.00
VC100133 Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus 5], codon optimized for human cell expression, AP_000220 10 ug
$289.00
VC100134 Myc-DDK-tagged ORF clone of viral ORF for 105 kD protein [Human adenovirus 5], codon optimized for human cell expression, AP_000221 10 ug
$289.00
VC100135 Myc-DDK-tagged ORF clone of viral ORF for E3 RID-alpha [Human adenovirus 5], codon optimized for human cell expression, AP_000222 10 ug
$225.00
VC100137 Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus 5], codon optimized for human cell expression, AP_000224 10 ug
$225.00
VC100138 Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus 5], codon optimized for human cell expression, AP_000225 10 ug
$289.00
VC100139 Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 5], codon optimized for human cell expression, AP_000226 10 ug
$289.00 $541.00
VC100140 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF6/7 [Human adenovirus 5], codon optimized for human cell expression, AP_000227 10 ug
$165.00
VC100141 Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus 5], codon optimized for human cell expression, AP_000228 10 ug
$480.00
VC100142 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus 5], codon optimized for human cell expression, AP_000229 10 ug
$289.00
VC100143 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus 5], codon optimized for human cell expression, AP_000230 10 ug
$289.00
VC100144 Myc-DDK-tagged ORF clone of viral ORF for E4 ORFB [Human adenovirus 5], codon optimized for human cell expression, AP_000231 10 ug
$289.00
VC100145 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF1 [Human adenovirus 5], codon optimized for human cell expression, AP_000232 10 ug
$289.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products