OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRMT1 (NM_001536) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG224239
PRMT1 (tGFP-tagged) - Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $657.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA380386 PRMT1 Rabbit polyclonal Antibody
100 ul
$410.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "PRMT1 or NM_001536"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PRMT1
Synonyms ANM1; HCP1; HRMT1L2; IR1B4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG224239 representing NM_001536
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCAGCCGAGGCCGCGAACTGCATCATGGAGAATTTTGTAGCCACCTTGGCTAATGGGATGAGCC
TCCAGCCGCCTCTTGAAGAAGTGTCCTGTGGCCAGGCGGAAAGCAGTGAGAAGCCCAACGCTGAGGACAT
GACATCCAAAGATTACTACTTTGACTCCTACGCACACTTTGGCATCCACGAGGAGATGCTGAAGGACGAG
GTGCGCACCCTCACTTACCGCAACTCCATGTTTCATAACCGGCACCTCTTCAAGGACAAGGTGGTGCTGG
ACGTCGGCTCGGGCACCGGCATCCTCTGCATGTTTGCTGCCAAGGCCGGGGCCCGCAAGGTCATCGGGAT
CGAGTGTTCCAGTATCTCTGATTATGCGGTGAAGATCGTCAAAGCCAACAAGTTAGACCACGTGGTGACC
ATCATCAAGGGGAAGGTGGAGGAGGTGGAGCTCCCAGTGGAGAAGGTGGACATCATCATCAGCGAGTGGA
TGGGCTACTGCCTCTTCTACGAGTCCATGCTCAACACCGTGCTCTATGCCCGGGACAAGTGGCTGGCGCC
CGATGGCCTCATCTTCCCAGACCGGGCCACGCTGTATGTGACGGCCATCGAGGACCGGCAGTACAAAGAC
TACAAGATCCACTGGTGGGAGAACGTGTATGGCTTCGACATGTCTTGCATCAAAGATGTGGCCATTAAGG
AGCCCCTAGTGGATGTCGTGGACCCCAAACAGCTGGTCACCAACGCCTGCCTCATAAAGGAGGTGGACAT
CTATACCGTCAAGGTGGAAGACCTGACCTTCACCTCCCCGTTCTGCCTGCAAGTGAAGCGGAATGACTAC
GTGCACGCCCTGGTGGCCTACTTCAACATCGAGTTCACACGCTGCCACAAGAGGACCGGCTTCTCCACCA
GCCCCGAGTCCCCGTACACGCACTGGAAGCAGACGGTGTTCTACATGGAGGACTACCTGACCGTGAAGAC
GGGCGAGGAGATCTTCGGCACCATCGGCATGCGGCCCAACGCCAAGAACAACCGGGACCTGGACTTCACC
ATCGACCTGGACTTCAAGGGCCAGCTGTGCGAGCTGTCCTGCTCCACCGACTACCGGATGCGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG224239 representing NM_001536
Red=Cloning site Green=Tags(s)

MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVT
IIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD
YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY
VHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT
IDLDFKGQLCELSCSTDYRMR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001536
ORF Size 1113 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001536.6
RefSeq Size 1386 bp
RefSeq ORF 1116 bp
Locus ID 3276
UniProt ID Q99873
Cytogenetics 19q13.33
Summary This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. provided by RefSeq, Dec 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001536" in other vectors (7)
SKU Description Size Price
RC224239 PRMT1 (Myc-DDK-tagged)-Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1 10 ug
$457.00
RC224239L1 Lenti ORF clone of Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC224239L2 Lenti ORF clone of Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC224239L3 Lenti ORF clone of Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC224239L4 Lenti ORF clone of Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, mGFP tagged 10 ug
$757.00
SC309036 PRMT1 (untagged)-Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1 10 ug
$503.00
SC317596 PRMT1 (untagged)-Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1 10 ug
$457.00

Plasmid Map for RG224239

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG224239
Circular map for RG224239

file-alt Citations

PRMT1-dependent methylation of BRCA1 contributes to the epigenetic defense of breast cancer cells against ionizing radiation
Montenegro, González-Guerrero, Sánchez-Del-Campo et al
Sci Rep (2020) 10 (1), 13275 DOI: 10.1038/s41598-020-70289-3
Cited by 38
AI Summary: In this study, OriGene products—specifically PRMT1 shRNA (OriGene, #TF311527) and BRCA1 antibody (OriGene, #TA800872)—were used to knock down PRMT1 expression and detect BRCA1 protein, respectively, enabling the authors to investigate how PRMT1-dependent methylation of BRCA1 contributes to breast cancer cell resistance to ionizing radiation.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products