OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGPEP1 (NM_017712) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG214837
PGPEP1 (tGFP-tagged) - Human pyroglutamyl-peptidase I (PGPEP1)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA331888 Rabbit Polyclonal Anti-PGPEP1 Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "PGPEP1 or NM_017712"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PGPEP1
Synonyms PAP-I; Pcp; PGI; PGP; PGP-I; PGPI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG214837 representing NM_017712
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCA
GTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGAT
TCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGCACAGTCCACAGCTGGTG
GTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACA
AGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGA
CTCCATCATCGACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATC
TCGCAGGATGCCGGCAGATATCTCTGCGACTTTACCTACTACACCTCTTTGTACCAGAGTCACGGTCGAT
CAGCCTTCGTCCACGTGCCCCCACTGGGGAAGCCGTACAACGCGGACCAGCTGGGCAGGGCACTGAGAGC
CATCATTGAGGAGATGTTGGACCTCCTGGAGCAGTCAGAGGGCAAAATCAACTATTGCCACAAACAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214837 representing NM_017712
Red=Cloning site Green=Tags(s)

MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV
VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI
SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_017712
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017712.4
RefSeq Size 2239 bp
RefSeq ORF 630 bp
Locus ID 54858
UniProt ID Q9NXJ5
Cytogenetics 19p13.11
Protein Families Druggable Genome, Protease
Summary The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. provided by RefSeq, Jul 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_017712" in other vectors (6)
SKU Description Size Price
RC214837 PGPEP1 (Myc-DDK-tagged)-Human pyroglutamyl-peptidase I (PGPEP1) 10 ug
$300.00
RC214837L1 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), Myc-DDK-tagged 10 ug
$600.00
RC214837L2 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), mGFP tagged 10 ug
$600.00
RC214837L3 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), Myc-DDK-tagged 10 ug
$600.00
RC214837L4 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), mGFP tagged 10 ug
$600.00
SC312465 PGPEP1 (untagged)-Human pyroglutamyl-peptidase I (PGPEP1) 10 ug
$300.00

Plasmid Map for RG214837

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG214837
Circular map for RG214837

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products