PGPEP1 (NM_017712) Human Tagged ORF Clone

SKU
RC214837
PGPEP1 (Myc-DDK-tagged)-Human pyroglutamyl-peptidase I (PGPEP1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PGPEP1
Synonyms PAP-I; Pcp; PGI; PGP; PGP-I; PGPI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214837 representing NM_017712
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCAGCCGAGGAAGGCGGTGGTAGTGACGGGATTTGGCCCTTTTGGGGAACACACCGTGAACGCCA
GTTGGATTGCAGTTCAGGAGCTAGAAAAGCTAGGCCTTGGCGACAGCGTGGACCTGCATGTGTACGAGAT
TCCGGTTGAGTACCAAACAGTCCAGAGACTCATCCCCGCCCTGTGGGAGAAGCACAGTCCACAGCTGGTG
GTGCATGTGGGGGTGTCAGGCATGGCGACCACAGTCACACTGGAGAAATGTGGACACAACAAGGGCTACA
AGGGGCTGGACAACTGCCGCTTTTGCCCCGGCTCCCAGTGCTGCGTGGAGGACGGGCCTGAAAGCATTGA
CTCCATCATCGACATGGATGCTGTGTGCAAGCGAGTCACCACGTTGGGCCTGGATGTGTCGGTGACCATC
TCGCAGGATGCCGGCAGATATCTCTGCGACTTTACCTACTACACCTCTTTGTACCAGAGTCACGGTCGAT
CAGCCTTCGTCCACGTGCCCCCACTGGGGAAGCCGTACAACGCGGACCAGCTGGGCAGGGCACTGAGAGC
CATCATTGAGGAGATGTTGGACCTCCTGGAGCAGTCAGAGGGCAAAATCAACTATTGCCACAAACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214837 representing NM_017712
Red=Cloning site Green=Tags(s)

MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV
VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI
SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017712
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017712.4
RefSeq Size 2239 bp
RefSeq ORF 630 bp
Locus ID 54858
UniProt ID Q9NXJ5
Cytogenetics 19p13.11
Protein Families Druggable Genome, Protease
MW 23 kDa
Summary The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:PGPEP1 (NM_017712) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214837L1 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), Myc-DDK-tagged 10 ug
$600.00
RC214837L2 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), mGFP tagged 10 ug
$600.00
RC214837L3 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), Myc-DDK-tagged 10 ug
$600.00
RC214837L4 Lenti ORF clone of Human pyroglutamyl-peptidase I (PGPEP1), mGFP tagged 10 ug
$600.00
RG214837 PGPEP1 (tGFP-tagged) - Human pyroglutamyl-peptidase I (PGPEP1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC312465 PGPEP1 (untagged)-Human pyroglutamyl-peptidase I (PGPEP1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.