OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Iba1 (AIF1) (NM_032955) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG203154
AIF1 (tGFP-tagged) - Human allograft inflammatory factor 1 (AIF1), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA308592 Rabbit polyclonal antibody to AIF1 (allograft inflammatory factor 1)
100 ul
$665.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Iba1 or NM_032955"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Iba1
Synonyms AIF-1; IBA1; IRT-1; IRT1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203154 representing NM_032955
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATT
CGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC

ATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTGAAACGAATGCTG
GAGAAACTTGGAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCC
AGTGGCTCCGGGGAGACGTTCAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGA
TCTGCCATCCTAAAAATGATCCTGATGTATGAGGAAAAAGCGAGAGAAAAGGAAAAGCCA
ACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCC

GACGCGTACGCGGCCGCTCGAGATGGAGAGCGACGAGAGCGGCCTGCCCGCCATGGAGATCGAGTGCCGCATCACCGGCACC
CTGAACGGCGTGGAGTTCGAGCT
Protein Sequence
>RG203154 protein sequence
Blue=ORF Red=Cloning site Green=Tag(s)

MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKR
SAILKMILMYEEKAREKEKPTGPPAKKAISELP

DAYAAARDGERRERPARHGDRVPHHRHPERRGVRAGGRRRGHPRAGPHDQQDEEHQRRPD
LQPLPAEPRDGLRLLPLRHLPQRLRE
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_032955
ORF Size 279 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032955.1, NP_116573.1
RefSeq Size 503 bp
RefSeq ORF 282 bp
Locus ID 199
UniProt ID P55008
Cytogenetics 6p21.33
Protein Families Druggable Genome
Summary This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_032955" in other vectors (6)
SKU Description Size Price
RC203154 AIF1 (Myc-DDK-tagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1 10 ug
$165.00
RC203154L1 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged 10 ug
$465.00
RC203154L2 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged 10 ug
$465.00
RC203154L3 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged 10 ug
$465.00
RC203154L4 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged 10 ug
$465.00
SC108920 AIF1 (untagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1 10 ug
$150.00

Plasmid Map for RG203154

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG203154
Circular map for RG203154

file-alt Citations

The Role of Allograft Inflammatory Factor-1 in the Effects of Experimental Diabetes on B Cell Functions in the Heart
Sarkar, Shukla, Alqatawni et al
Front Cardiovasc Med (2018) 5, 126 DOI: 10.3389/fcvm.2018.00126
AI Summary: OriGene’s pCMV6-AC-GFP vector was used to generate GFP-AIF-1 expression constructs, enabling the study of AIF-1’s role in B cell migration and cardiac function in diabetic mice.
Snippet: The full-length mouse AIF-1 cDNA was PCR-amplified and inserted into the KpnI-NotI sites of the pCMV6-AC-GFP vector (Origene, MD, USA). After transformation to E. coli DH5α strain, clones were selected on solid LB media containing 50mg/L ampicillin. Multiple colonies were screened by colony PCR. After selecting the positive recombinant pCMV-AC-GFP-AIF-1, the plasmid DNA was extracted from the over...
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products