Iba1 (AIF1) (NM_032955) Human Tagged ORF Clone
SKU
RC203154
AIF1 (Myc-DDK-tagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Iba1 |
Synonyms | AIF-1; IBA1; IRT-1; IRT1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC203154 representing NM_032955
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTGAAACGAATGCTGGAGAAACTTG GAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCCAGTGGCTCCGGGGAGACGTT CAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCATCCTAAAAATGATCCTGATGTAT GAGGAAAAAGCGAGAGAAAAGGAAAAGCCAACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203154 representing NM_032955
Red=Cloning site Green=Tags(s) MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY EEKAREKEKPTGPPAKKAISELP myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_032955 |
ORF Size | 279 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_032955.3 |
RefSeq Size | 503 bp |
RefSeq ORF | 282 bp |
Locus ID | 199 |
UniProt ID | P55008 |
Cytogenetics | 6p21.33 |
Protein Families | Druggable Genome |
MW | 10.5 kDa |
Summary | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC203154L1 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged | 10 ug |
$465.00
|
|
RC203154L2 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged | 10 ug |
$465.00
|
|
RC203154L3 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged | 10 ug |
$465.00
|
|
RC203154L4 | Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged | 10 ug |
$465.00
|
|
RG203154 | AIF1 (tGFP-tagged) - Human allograft inflammatory factor 1 (AIF1), transcript variant 1 | 10 ug |
$489.00
|
|
SC108920 | AIF1 (untagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.