Iba1 (AIF1) (NM_032955) Human Tagged ORF Clone

SKU
RC203154
AIF1 (Myc-DDK-tagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Iba1
Synonyms AIF-1; IBA1; IRT-1; IRT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203154 representing NM_032955
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTGAAACGAATGCTGGAGAAACTTG
GAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCCAGTGGCTCCGGGGAGACGTT
CAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCATCCTAAAAATGATCCTGATGTAT
GAGGAAAAAGCGAGAGAAAAGGAAAAGCCAACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203154 representing NM_032955
Red=Cloning site Green=Tags(s)

MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY
EEKAREKEKPTGPPAKKAISELP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032955
ORF Size 279 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032955.3
RefSeq Size 503 bp
RefSeq ORF 282 bp
Locus ID 199
UniProt ID P55008
Cytogenetics 6p21.33
Protein Families Druggable Genome
MW 10.5 kDa
Summary This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:Iba1 (AIF1) (NM_032955) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203154L1 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged 10 ug
$465.00
RC203154L2 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged 10 ug
$465.00
RC203154L3 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, Myc-DDK-tagged 10 ug
$465.00
RC203154L4 Lenti ORF clone of Human allograft inflammatory factor 1 (AIF1), transcript variant 1, mGFP tagged 10 ug
$465.00
RG203154 AIF1 (tGFP-tagged) - Human allograft inflammatory factor 1 (AIF1), transcript variant 1 10 ug
$489.00
SC108920 AIF1 (untagged)-Human allograft inflammatory factor 1 (AIF1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.