OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EPCAM (NM_002354) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201989
EPCAM (tGFP-tagged) - Human epithelial cell adhesion molecule (EPCAM)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA506627 EPCAM mouse monoclonal antibody, clone OTI1H9 (formerly 1H9) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "EPCAM or NM_002354"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EPCAM
Synonyms DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201989 representing NM_002354
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCCCGCAGGTCCTCGCGTTCGGGCTTCTGCTTGCCGCGGCGACGGCGACTTTTGCCGCAGCTC
AGGAAGAATGTGTCTGTGAAAACTACAAGCTGGCCGTAAACTGCTTTGTGAATAATAATCGTCAATGCCA
GTGTACTTCAGTTGGTGCACAAAATACTGTCATTTGCTCAAAGCTGGCTGCCAAATGTTTGGTGATGAAG
GCAGAAATGAATGGCTCAAAACTTGGGAGAAGAGCAAAACCTGAAGGGGCCCTCCAGAACAATGATGGGC
TTTATGATCCTGACTGCGATGAGAGCGGGCTCTTTAAGGCCAAGCAGTGCAACGGCACCTCCACGTGCTG
GTGTGTGAACACTGCTGGGGTCAGAAGAACAGACAAGGACACTGAAATAACCTGCTCTGAGCGAGTGAGA
ACCTACTGGATCATCATTGAACTAAAACACAAAGCAAGAGAAAAACCTTATGATAGTAAAAGTTTGCGGA
CTGCACTTCAGAAGGAGATCACAACGCGTTATCAACTGGATCCAAAATTTATCACGAGTATTTTGTATGA
GAATAATGTTATCACTATTGATCTGGTTCAAAATTCTTCTCAAAAAACTCAGAATGATGTGGACATAGCT
GATGTGGCTTATTATTTTGAAAAAGATGTTAAAGGTGAATCCTTGTTTCATTCTAAGAAAATGGACCTGA
CAGTAAATGGGGAACAACTGGATCTGGATCCTGGTCAAACTTTAATTTATTATGTTGATGAAAAAGCACC
TGAATTCTCAATGCAGGGTCTAAAAGCTGGTGTTATTGCTGTTATTGTGGTTGTGGTGATAGCAGTTGTT
GCTGGAATTGTTGTGCTGGTTATTTCCAGAAAGAAGAGAATGGCAAAGTATGAGAAGGCTGAGATAAAGG
AGATGGGTGAGATGCATAGGGAACTCAATGCA

ACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201989 representing NM_002354
Red=Cloning site Green=Tags(s)

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

TRPLE - GFP Tag - V
Restriction Sites SgfI-NotI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002354
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002354.1, NP_002345.1
RefSeq Size 1528 bp
RefSeq ORF 945 bp
Locus ID 4072
UniProt ID P16422
Cytogenetics 2p21
Domains thyroglobulin_1
Protein Families ES Cell Differentiation/IPS, Transmembrane
Summary This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. provided by RefSeq, Dec 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002354" in other vectors (7)
SKU Description Size Price
RC201989 EPCAM (Myc-DDK-tagged)-Human epithelial cell adhesion molecule (EPCAM) 10 ug
$300.00
RC201989L1 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), Myc-DDK-tagged 10 ug
$600.00
RC201989L2 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), mGFP tagged 10 ug
$600.00
RC201989L3 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), Myc-DDK-tagged 10 ug
$600.00
RC201989L4 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), mGFP tagged 10 ug
$600.00
SC118692 EPCAM (untagged)-Human epithelial cell adhesion molecule (EPCAM) 10 ug
$300.00
SC322331 EPCAM (untagged)-Human epithelial cell adhesion molecule (EPCAM) 10 ug
$300.00

Plasmid Map for RG201989

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201989
Circular map for RG201989

file-alt Citations

EpCAM promotes endosomal modulation of the cortical RhoA zone for epithelial organization
Gaston, De Beco, Doss et al
Nat Commun (2021) 12 (1), 2226 DOI: 10.1038/s41467-021-22482-9
Cited by 25
AI Summary: In this study, the EpCAM-GFP plasmid from OriGene (Cat# RG201989) was used to investigate the role of EpCAM in modulating RhoA activity and actomyosin organization during epithelial cell polarization.
Snippet: using two siRNAs targeting dog EPCAM mRNA, purchased from Invitrogen. A detailed list of the primers, shRNA, and siRNA constructs is provided in Supplementary Table 1. EpCAM-GFP was purchased from Origene (NM_002354, CAT# RG201989). Rab11-dominant-negative mutant was purchased from Addgene (#12678). AHPH-GFP, AHPH-mCherry, AHPHA740D, ROCK1-GBD-GFP, and mDia-GBD-GFP constructs were a kind gift f
Endosomal spatio-temporal modulation of the cortical RhoA zone conditions epithelial cell organization
Gaston, De Beco, Doss et al
bioRxiv (2020)
Snippet: …EpCAM reduction in MDCK cells was carried out 614 using two siRNA targeting dog EpCAM mRNA, purchased from Invitrogen: siRNA EpCAM #1: 5’- 615 UUCAUAACCAAACAUUUGGUUGCCA -3’, siRNA EpCAM #2: 5’ – 616 UGAUUGAGAGCUGCCUUUCUAUUUA -3’. EpCAM-GFP was purchased from Origene 617 (NM_002354, CAT# RG201989). …
The IgM CH2 domain as covalently linked homodimerization module for the generation of fusion proteins with dual specificity
Seifert, Plappert, Heidel et al
Protein Eng. Des. Sel. (2012) 25 (10), 603-12 DOI: 10.1093/protein/gzs059
Cited by 19
AI Summary: OriGene contributed to this study by providing the plasmid containing the full-length open reading frame of human EpCAM (product: RG201989), which was used for generating and analyzing fusion proteins with dual specificity.
Snippet: Germany). Plasmids containing the full-length open reading frame of human EGFR, HER2, HER3 and EpCAM were purchased from GeneCopoeia (EX-A275-M02, EX-Z2866-M02, EX-M0854-M02) or OriGene (RG201989).
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products