EPCAM (NM_002354) Human Tagged ORF Clone

SKU
RC201989
EPCAM (Myc-DDK-tagged)-Human epithelial cell adhesion molecule (EPCAM)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EPCAM
Synonyms DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201989 representing NM_002354
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCCCGCAGGTCCTCGCGTTCGGGCTTCTGCTTGCCGCGGCGACGGCGACTTTTGCCGCAGCTC
AGGAAGAATGTGTCTGTGAAAACTACAAGCTGGCCGTAAACTGCTTTGTGAATAATAATCGTCAATGCCA
GTGTACTTCAGTTGGTGCACAAAATACTGTCATTTGCTCAAAGCTGGCTGCCAAATGTTTGGTGATGAAG
GCAGAAATGAATGGCTCAAAACTTGGGAGAAGAGCAAAACCTGAAGGGGCCCTCCAGAACAATGATGGGC
TTTATGATCCTGACTGCGATGAGAGCGGGCTCTTTAAGGCCAAGCAGTGCAACGGCACCTCCACGTGCTG
GTGTGTGAACACTGCTGGGGTCAGAAGAACAGACAAGGACACTGAAATAACCTGCTCTGAGCGAGTGAGA
ACCTACTGGATCATCATTGAACTAAAACACAAAGCAAGAGAAAAACCTTATGATAGTAAAAGTTTGCGGA
CTGCACTTCAGAAGGAGATCACAACGCGTTATCAACTGGATCCAAAATTTATCACGAGTATTTTGTATGA
GAATAATGTTATCACTATTGATCTGGTTCAAAATTCTTCTCAAAAAACTCAGAATGATGTGGACATAGCT
GATGTGGCTTATTATTTTGAAAAAGATGTTAAAGGTGAATCCTTGTTTCATTCTAAGAAAATGGACCTGA
CAGTAAATGGGGAACAACTGGATCTGGATCCTGGTCAAACTTTAATTTATTATGTTGATGAAAAAGCACC
TGAATTCTCAATGCAGGGTCTAAAAGCTGGTGTTATTGCTGTTATTGTGGTTGTGGTGATAGCAGTTGTT
GCTGGAATTGTTGTGCTGGTTATTTCCAGAAAGAAGAGAATGGCAAAGTATGAGAAGGCTGAGATAAAGG
AGATGGGTGAGATGCATAGGGAACTCAATGCA


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201989 representing NM_002354
Red=Cloning site Green=Tags(s)

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

TRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-NotI Cloning Scheme for this gene Plasmid Map
ACCN NM_002354
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002354.1, NP_002345.1
RefSeq Size 1528 bp
RefSeq ORF 945 bp
Locus ID 4072
UniProt ID P16422
Cytogenetics 2p21
Domains thyroglobulin_1
Protein Families ES Cell Differentiation/IPS, Transmembrane
MW 34.9 kDa
Summary This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:EPCAM (NM_002354) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201989L1 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), Myc-DDK-tagged 10 ug
$600.00
RC201989L2 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), mGFP tagged 10 ug
$600.00
RC201989L3 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), Myc-DDK-tagged 10 ug
$600.00
RC201989L4 Lenti ORF clone of Human epithelial cell adhesion molecule (EPCAM), mGFP tagged 10 ug
$600.00
RG201989 EPCAM (tGFP-tagged) - Human epithelial cell adhesion molecule (EPCAM) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118692 EPCAM (untagged)-Human epithelial cell adhesion molecule (EPCAM) 10 ug
$300.00
SC322331 EPCAM (untagged)-Human epithelial cell adhesion molecule (EPCAM) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.