OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DDIT3 (NM_004083) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201301
DDIT3 (tGFP-tagged) - Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA802210 DDIT3 mouse monoclonal antibody,clone OTI3H7 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "DDIT3 or NM_004083"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DDIT3
Synonyms AltDDIT3; C/EBPzeta; CEBPZ; CHOP; CHOP-10; CHOP10; GADD153
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201301 representing NM_004083
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCTGAGTCATTGCCTTTCTCCTTTGGGACACTGTCCAGCTGGGAGCTGGAAGCCTGGTATGAGG
ACCTGCAAGAGGTCCTGTCTTCAGATGAAAATGGGGGTACCTATGTTTCACCTCCTGGAAATGAAGAGGA
AGAATCAAAAATCTTCACCACTCTTGACCCTGCTTCTCTGGCTTGGCTGACTGAGGAGGAGCCAGAACCA
GCAGAGGTCACAAGCACCTCCCAGAGCCCTCACTCTCCAGATTCCAGTCAGAGCTCCCTGGCTCAGGAGG
AAGAGGAGGAAGACCAAGGGAGAACCAGGAAACGGAAACAGAGTGGTCATTCCCCAGCCCGGGCTGGAAA
GCAGCGCATGAAGGAGAAAGAACAGGAGAATGAAAGGAAAGTGGCACAGCTAGCTGAAGAGAATGAACGG
CTCAAGCAGGAAATCGAGCGCCTGACCAGGGAAGTAGAGGCGACTCGCCGAGCTCTGATTGACCGAATGG
TGAATCTGCACCAAGCA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201301 representing NM_004083
Red=Cloning site Green=Tags(s)

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEP
AEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENER
LKQEIERLTREVEATRRALIDRMVNLHQA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004083
ORF Size 507 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004083.3
RefSeq Size 927 bp
RefSeq ORF 510 bp
Locus ID 1649
UniProt ID P35638
Cytogenetics 12q13.3
Domains BRLZ
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
Summary This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. provided by RefSeq, Aug 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004083" in other vectors (7)
SKU Description Size Price
RC201301 DDIT3 (Myc-DDK-tagged)-Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5 10 ug
$300.00
RC201301L1 Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5, Myc-DDK-tagged 10 ug
$600.00
RC201301L2 Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5, mGFP tagged 10 ug
$600.00
RC201301L3 Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5, Myc-DDK-tagged 10 ug
$600.00
RC201301L4 Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5, mGFP tagged 10 ug
$600.00
SC117581 DDIT3 (untagged)-Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5 10 ug
$300.00
SC324377 DDIT3 (untagged)-Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 5 10 ug
$300.00

Plasmid Map for RG201301

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201301
Circular map for RG201301

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products