OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MERTK (NM_006343) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC600074
MERTK (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens c-mer proto-oncogene tyrosine kinase, Signal peptide (1-20) plus EC domain (21-505)
AAV Particle:
DDK
$289.00 $470.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA322506 Anti-MERTK Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "MERTK or NM_006343"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MERTK
Synonyms c-Eyk; c-mer; MER; RP38; Tyro12
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>RC600074 representing leader sequence plus the extracellular domain region of NM_006343
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGCC

ATGGGGCCGGCCCCGCTGCCGCTGCTGCTGGGCCTCTTCCTCCCCGCGCTCTGGCGTAGAGCTATCACTG
AGGCAAGGGAAGAAGCCAAGCCTTACCCGCTATTCCCGGGACCTTTTCCAGGGAGCCTGCAAACTGACCA
CACACCGCTGTTATCCCTTCCTCACGCCAGTGGGTACCAGCCTGCCTTGATGTTTTCACCAACCCAGCCT
GGAAGACCACATACAGGAAACGTAGCCATTCCCCAGGTGACCTCTGTCGAATCAAAGCCCCTACCGCCTC
TTGCCTTCAAACACACAGTTGGACACATAATACTTTCTGAACATAAAGGTGTCAAATTTAATTGCTCAAT
CAGTGTACCTAATATATACCAGGACACCACAATTTCTTGGTGGAAAGATGGGAAGGAATTGCTTGGGGCA
CATCATGCAATTACACAGTTTTATCCAGATGATGAAGTTACAGCAATAATCGCTTCCTTCAGCATAACCA
GTGTGCAGCGTTCAGACAATGGGTCGTATATCTGTAAGATGAAAATAAACAATGAAGAGATCGTGTCTGA
TCCCATCTACATCGAAGTACAAGGACTTCCTCACTTTACTAAGCAGCCTGAGAGCATGAATGTCACCAGA
AACACAGCCTTCAACCTCACCTGTCAGGCTGTGGGCCCGCCTGAGCCCGTCAACATTTTCTGGGTTCAAA
ACAGTAGCCGTGTTAACGAACAGCCTGAAAAATCCCCCTCCGTGCTAACTGTTCCAGGCCTGACGGAGAT
GGCGGTCTTCAGTTGTGAGGCCCACAATGACAAAGGGCTGACCGTGTCCAAGGGAGTGCAGATCAACATC
AAAGCAATTCCCTCCCCACCAACTGAAGTCAGCATCCGTAACAGCACTGCACACAGCATTCTGATCTCCT
GGGTTCCTGGTTTTGATGGATACTCCCCGTTCAGGAATTGCAGCATTCAGGTCAAGGAAGCTGATCCGCT
GAGTAATGGCTCAGTCATGATTTTTAACACCTCTGCCTTACCACATCTGTACCAAATCAAGCAGCTGCAA
GCCCTGGCTAATTACAGCATTGGTGTTTCCTGCATGAATGAAATAGGCTGGTCTGCAGTGAGCCCTTGGA
TTCTAGCCAGCACGACTGAAGGAGCCCCATCAGTAGCACCTTTAAATGTCACTGTGTTTCTGAATGAATC
TAGTGATAATGTGGACATCAGATGGATGAAGCCTCCGACTAAGCAGCAGGATGGAGAACTGGTGGGCTAC
CGGATATCCCACGTGTGGCAGAGTGCAGGGATTTCCAAAGAGCTCTTGGAGGAAGTTGGCCAGAATGGCA
GCCGAGCTCGGATCTCTGTTCAAGTCCACAATGCTACGTGCACAGTGAGGATTGCAGCCGTCACCAGAGG
GGGAGTTGGGCCCTTCAGTGATCCAGTGAAAATATTTATCCCTGCACACGGTTGGGTAGATTATGCCCCC
TCTTCAACTCCGGCGCCTGGCAACGCAGATCCTGTGCTCATCATC

ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
TGGTACCGATATCAAGCTTGTCGACTCTAGA
Protein Sequence
>RC600074 representing signal peptide plus the extracellular domain region of NM_006343
Red=Cloning sites Green= DDK and 6XHIS Tags

MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQP
GRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGA
HHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTR
NTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINI
KAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQ
ALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAP
SSTPAPGNADPVLII

TRSGTRSGDYKDDDDKGSHHHHHH
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_006343
ORF Size 1515 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006343.2, NP_006334.2
RefSeq Size 3632 bp
RefSeq ORF 3000 bp
Locus ID 10461
UniProt ID Q12866
Cytogenetics 2q13
Domains FN3, ig, IG, pkinase, S_TKc, TyrKc
Protein Families Druggable Genome, Protein Kinase, Transmembrane
MW 54.9 kDa
Summary This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP). provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006343" in other vectors (8)
SKU Description Size Price
RC215289 MERTK (Myc-DDK-tagged)-Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,372.00
RC215289L1 Lenti-ORF clone of MERTK (Myc-DDK-tagged)-Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,672.00
RC215289L2 Lenti-ORF clone of MERTK (mGFP-tagged)-Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,672.00
RC215289L3 Lenti-ORF clone of MERTK (Myc-DDK-tagged)-Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,672.00
RC215289L4 Lenti-ORF clone of MERTK (mGFP-tagged)-Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,672.00
RG215289 MERTK (tGFP-tagged) - Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,572.00
SC116132 MERTK (untagged)-Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,373.00
SC323434 MERTK (untagged)-Kinase deficient mutant (K619M) of Human c-mer proto-oncogene tyrosine kinase (MERTK) 10 ug
$1,373.00

file-alt Citations

TYRO3 agonist as a novel therapy for glomerular disease
Zhong, Cai, Fu et al
JCI Insight (2022) 8 (1) DOI: 10.1172/jci.insight.165207
Cited by 11
AI Summary: OriGene’s overexpression plasmids for Mer (RC600074) and Axl (RC206431) were used to generate podocyte cell lines stably expressing these TAM receptors, enabling the study to assess the selectivity and efficacy of the novel TYRO3 agonist in comparison to related receptors.
Snippet: …While the roles of MER and AXL in these cancer processes have been well described, less is known about the roles of TYRO3. In addition, many stud;Overexpression plasmids of Mer and Axl (Origene Techonlogies, Inc. # RC600074 and # RC206431, respectively) were subcloned into a lentivector construct, similarly as described for TYRO3 (17), and podocytes with stable expression of each TAM receptor were selected using blasticidin
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products