OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TEAD4 (NM_003213) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC219686
TEAD4 (Myc-DDK-tagged)-Human TEA domain family member 4 (TEAD4), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA308632 Rabbit polyclonal antibody to TEAD4 (TEA domain family member 4)
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TEAD4 or NM_003213"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TEAD4
Synonyms EFTR-2; hRTEF-1B; RTEF1; TCF13L1; TEF-3; TEF3; TEFR-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219686 representing NM_003213
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGGCACGGCCGGCACCATTACCTCCAACGAGTGGAGCTCTCCCACCTCCCCTGAGGGGAGCACCG
CCTCTGGGGGCAGTCAGGCACTGGACAAGCCCATCGACAATGACGCAGAGGGCGTGTGGAGCCCGGATAT
TGAGCAGAGTTTCCAGGAGGCCCTCGCCATCTACCCGCCCTGTGGCAGGCGCAAAATCATCCTGTCGGAC
GAGGGCAAGATGTATGGTCGGAACGAGCTGATTGCCCGCTACATCAAGCTCCGGACAGGGAAGACCCGCA
CCAGGAAGCAGGTCTCCAGCCACATCCAGGTGCTGGCTCGTCGCAAAGCTCGCGAGATCCAGGCCAAGCT
AAAGGACCAGGCAGCTAAGGACAAGGCCCTGCAGAGCATGGCTGCCATGTCGTCTGCACAGATCATCTCC
GCCACGGCCTTCCACAGTAGCATGGCCCTCGCCCGGGGCCCCGGCCGCCCAGCAGTCTCAGGGTTTTGGC
AAGGAGCTTTGCCAGGCCAAGCCGGAACGTCCCATGATGTGAAGCCTTTCTCTCAGCAAACCTATGCTGT
CCAGCCTCCGCTGCCTCTGCCAGGGTTTGAGTCTCCTGCAGGGCCCGCCCCATCGCCCTCTGCGCCCCCG
GCACCCCCATGGCAGGGCCGCAGCGTGGCCAGCTCCAAGCTCTGGATGTTGGAGTTCTCTGCCTTCCTGG
AGCAGCAGCAGGACCCGGACACGTACAACAAGCACCTGTTCGTGCACATTGGCCAGTCCAGCCCAAGCTA
CAGCGACCCCTACCTCGAAGCCGTGGACATCCGCCAAATCTATGACAAATTCCCGGAGAAAAAGGGTGGA
CTCAAGGATCTCTTCGAACGGGGACCCTCCAATGCCTTTTTTCTTGTGAAGTTCTGGGCAGACCTCAACA
CCAACATCGAGGATGAAGGCAGCTCCTTCTATGGGGTCTCCAGCCAGTATGAGAGCCCCGAGAACATGAT
CATCACCTGCTCCACGAAGGTCTGCTCTTTCGGCAAGCAGGTGGTGGAGAAAGTTGAGACAGAGTATGCT
CGCTATGAGAATGGACACTACTCTTACCGCATCCACCGGTCCCCGCTCTGTGAGTACATGATCAACTTCA
TCCACAAGCTCAAGCACCTCCCTGAGAAGTACATGATGAACAGCGTGCTGGAGAACTTCACCATCCTGCA
GGTGGTCACCAACAGAGACACACAGGAGACCTTGCTGTGCATTGCCTATGTCTTTGAGGTGTCAGCCAGT
GAGCACGGGGCTCAGCACCACATCTACAGGCTGGTGAAAGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC219686 representing NM_003213
Red=Cloning site Green=Tags(s)

MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSD
EGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIIS
ATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPP
APPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGG
LKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYA
RYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS
EHGAQHHIYRLVKE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003213
ORF Size 1302 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003213.4
RefSeq Size 1798 bp
RefSeq ORF 1305 bp
Locus ID 7004
UniProt ID Q15561
Cytogenetics 12p13.33
Domains TEA
Protein Families Transcription Factors
MW 48.3 kDa
Summary This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003213" in other vectors (6)
SKU Description Size Price
RC219686L1 Lenti ORF clone of Human TEA domain family member 4 (TEAD4), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC219686L2 Lenti ORF clone of Human TEA domain family member 4 (TEAD4), transcript variant 1, mGFP tagged 10 ug
$986.00
RC219686L3 Lenti ORF clone of Human TEA domain family member 4 (TEAD4), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC219686L4 Lenti ORF clone of Human TEA domain family member 4 (TEAD4), transcript variant 1, mGFP tagged 10 ug
$986.00
RG219686 TEAD4 (tGFP-tagged) - Human TEA domain family member 4 (TEAD4), transcript variant 1 10 ug
$489.00 $886.00
SC111037 TEAD4 (untagged)-Human TEA domain family member 4 (TEAD4), transcript variant 1 10 ug
$457.00

Plasmid Map for RC219686

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC219686
Circular map for RC219686

file-alt Citations

YAP antagonizes TEAD-mediated AR signaling and prostate cancer growth
Li, Zhuo, Cho et al
EMBO J (2023)
Cited by 43
AI Summary: OriGene contributed to this study by providing the human TEAD4 constructs (Cat. No. RC219686), which were used to investigate the role of TEAD4 in androgen receptor signaling and prostate cancer growth.
Snippet: in which T2A sequence was replaced by UBC promotor. pLenti CMV rtTA3 Hygro (Addgene plasmid, Cat. No. 26730) was used to generate Dox-inducible cell lines. The human TEAD4 constructs were purchased from Origene (https://www.origene.com/;RC219686). TEA
YAP inhibits ERα and ER+ breast cancer growth by disrupting a TEAD-ERα signaling axis
Li, Zhuo, Zhuang et al
Nat Commun (2022) 13 (1), 3075 DOI: 10.1038/s41467-022-30831-5
Cited by 76
AI Summary: OriGene contributed to this study by providing the TEAD4 constructs (catalog number RC219686), which were used to investigate the molecular interactions between TEAD4, YAP, and ERα in ER+ breast cancer cells.
Snippet: …YAP is amplified and its protein level and nuclear localization are elevated in many human cancers including liver, lung, colon, esophageal, and cervical cancers9,10,17,18. Furtherm;The TEAD4 constructs were purchased from Origene (https://www.origene.com/;RC219686)
TEAD4 Induced Positive Feedback Activation of E2R/YAP1 Axis and Promoted Epithelial-mesenchymal Transition through Up-regulating TWIST1 Directly in HCC
Liu, Ke, Shang et al
Research Square (2021)
Snippet: Human TEAD4-expressing plasmid (Catalog. No.: RC219686) and TWIST1-expressing plasmid (Catalog. No.: RC202920) were purchased from OriGene Technologies, Inc (Rockville, USA). Luciferase reporter plasmids containing the
Remodeling cancer stemness by collagen/fibronectin via the AKT and CDC42 signaling pathway crosstalk in glioma
Zhong, Tao, Tang et al
Theranostics (2021) 11 (4), 1991-2005 DOI: 10.7150/thno.50613
Cited by 70
AI Summary: In this study, OriGene’s pCMV-YAP1 and pCMV-TEAD4 plasmids were used to investigate the role of YAP1 and TEAD4 in glioma cells, helping to elucidate how collagen and fibronectin remodel cancer stemness through the AKT and CDC42 signaling pathways.
Snippet: LN229 or T98G cells were co-transfected with Renilla vectors and pGL4.11-NUPR1 using FuGENE HD Transfection Reagent (Roche, NJ, USA) for 6 h. Next, LN229 or T98G cells were transfected with pCMV-YAP1 (Origene, CA, USA) and pCMV-TEAD4 (Origene, CA
FigureFigureFigure
Transcriptional cofactor Vgll2 is required for functional adaptations of skeletal muscle induced by chronic overload
Honda, Tsuchimochi, Hitachi et al
J. Cell. Physiol. (2019)
AI Summary: OriGene contributed to this study by providing the C-terminal Myc-DDK-tagged Human TEAD4 expression plasmid (RC219686), which was used to investigate the molecular interactions underlying skeletal muscle adaptation to chronic overload.
Snippet: Japan;Kitagawa, 2007). The expression plasmid for the C‐terminal Myc‐DDK‐tagged Human TEAD4 was purchased from OriGene (RC219686;Rockville, MD). 2.11 Luciferase reporter assay. Subconfluent C2C12 cells cultured
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products