OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EDARADD (NM_080738) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC219198
EDARADD (Myc-DDK-tagged)-Human EDAR-associated death domain (EDARADD), transcript variant B
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365280 EDARADD rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "EDARADD or NM_080738"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EDARADD
Synonyms ECTD11A; ECTD11B; ED3; EDA3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219198 representing NM_080738
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCACCGGACGACCCTCTGCGCGCAGATCATATGGTAAAGGAACCAGTGGAAGACACAGACCCTA
GCACTTTATCCTTTAATATGTCAGACAAATATCCCATTCAAGATACGGAACTCCCTAAAGCTGAAGAATG
TGATACAATTACTTTGAACTGCCCACGAAATTCAGATATGAAAAATCAGGGAGAAGAAAATGGCTTTCCA
GATAGCACTGGAGATCCTCTTCCAGAGATCAGCAAGGACAACTCCTGCAAAGAAAACTGTACTTGTTCCT
CCTGCTTGCTCCGGGCCCCCACCATAAGTGACTTGCTCAATGATCAGGACTTACTAGATGTGATCAGGAT
AAAGCTGGATCCGTGTCACCCAACGGTGAAAAACTGGAGGAATTTTGCAAGCAAATGGGGGATGTCCTAT
GACGAATTGTGCTTCCTGGAGCAGAGGCCACAGAGCCCCACCTTGGAGTTCTTGCTCCGGAACAGTCAGA
GGACGGTGGGCCAGCTGATGGAGCTCTGCAGGCTCTACCACAGGGCCGACGTGGAGAAGGTTCTGCGCAG
GTGGGTGGACGAGGAGTGGCCCAAGCGGGAGCGTGGAGACCCCTCCAGGCACTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC219198 representing NM_080738
Red=Cloning site Green=Tags(s)

MASPDDPLRADHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFP
DSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSY
DELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_080738
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080738.4
RefSeq Size 2891 bp
RefSeq ORF 618 bp
Locus ID 128178
UniProt ID Q8WWZ3
Cytogenetics 1q42.3-q43
Domains enolase
Protein Families Druggable Genome
MW 23.5 kDa
Summary This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_080738" in other vectors (6)
SKU Description Size Price
RC219198L1 Lenti ORF clone of Human EDAR-associated death domain (EDARADD), transcript variant B, Myc-DDK-tagged 10 ug
$600.00
RC219198L2 Lenti ORF clone of Human EDAR-associated death domain (EDARADD), transcript variant B, mGFP tagged 10 ug
$600.00
RC219198L3 Lenti ORF clone of Human EDAR-associated death domain (EDARADD), transcript variant B, Myc-DDK-tagged 10 ug
$600.00
RC219198L4 Lenti ORF clone of Human EDAR-associated death domain (EDARADD), transcript variant B, mGFP tagged 10 ug
$600.00
RG219198 EDARADD (tGFP-tagged) - Human EDAR-associated death domain (EDARADD), transcript variant B 10 ug
$500.00
SC120378 EDARADD (untagged)-Human EDAR-associated death domain (EDARADD), transcript variant B 10 ug
$300.00

Plasmid Map for RC219198

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC219198
Circular map for RC219198

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products