OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DOC2B (NM_003585) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC218949
DOC2B (Myc-DDK-tagged)-Human double C2-like domains, beta (DOC2B)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DOC2B or NM_003585"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DOC2B
Synonyms DOC2BL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218949 representing NM_003585
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCTCCGGCGGCGCGGGGAGAAGGCGACCATCAGCATCCAGGAGCATATGGCCATCGACGTGTGCC
CCGGCCCCATCCGTCCCATCAAGCAGATCTCCGACTACTTCCCCCGCTTCCCGCGGGGCCTGCCCCCGGA
CGCCGGGCCCCGAGCCGCTGCACCCCCGGACGCCCCCGCGCGCCCGGCTGTGGCCGGTGCCGGCCGCCGC
AGCCCCTCCGACGGCGCCCGCGAGGACGACGAGGATGTGGACCAGCTCTTCGGAGCCTACGGCTCCAGCC
CGGGCCCCAGCCCGGGTCCCAGCCCCGCGCGGCCGCCAGCCAAGCCGCCGGAGGACGAGCCGGACGCCGA
CGGCTACGAGTCGGACGACTGCACTGCCCTGGGCACGCTGGACTTCAGCCTGCTGTATGACCAGGAGAAC
AACGCCCTCCACTGCACCATCACCAAGGCCAAGGGCCTGAAGCCAATGGACCACAATGGGCTGGCAGACC
CCTACGTCAAGCTGCACCTGCTGCCAGGAGCCAGTAAGGCAAATAAGCTCAGAACAAAAACTCTCCGTAA
CACTCTGAACCCCACATGGAACGAGACCCTCACTTACTACGGGATCACAGATGAAGACATGATCCGCAAG
ACCCTGCGGATCTCTGTGTGTGACGAGGACAAATTCCGGCACAATGAGTTCATCGGGGAGACACGTGTGC
CCCTGAAGAAGCTGAAACCCAACCACACCAAGACCTTCAGCATCTGCCTGGAGAAGCAGCTGCCGGTGGA
CAAGACCGAAGACAAGTCCCTGGAGGAGCGGGGCCGCATCCTCATCTCGCTCAAGTACAGCTCACAGAAG
CAAGGCCTGCTGGTAGGCATCGTGCGGTGCGCCCACCTGGCCGCCATGGACGCCAACGGCTACTCGGACC
CCTACGTGAAAACATACCTGAGGCCAGATGTGGACAAGAAATCCAAACATAAGACAGCGGTGAAGAAAAA
AACCCTGAACCCGGAGTTTAATGAGGAGTTCTGTTACGAGATCAAGCATGGGGACCTGGCCAAGAAGTCC
CTGGAGGTCACCGTTTGGGATTACGACATTGGAAAATCCAACGATTTCATTGGTGGTGTGGTTCTGGGCA
TCCACGCCAAGGGGGAGCGCCTGAAGCACTGGTTTGACTGCCTGAAGAACAAGGACAAGCGCATCGAGCG
CTGGCACACGCTCACCAGCGAGCTCCCAGGGGCTGTGCTCAGCGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218949 representing NM_003585
Red=Cloning site Green=Tags(s)

MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPARPAVAGAGRR
SPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQEN
NALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRK
TLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKTEDKSLEERGRILISLKYSSQK
QGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKS
LEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSELPGAVLSD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003585
ORF Size 1236 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003585.3
RefSeq Size 2030 bp
RefSeq ORF 1239 bp
Locus ID 8447
UniProt ID Q14184
Cytogenetics 17p13.3
MW 45.8 kDa
Summary There are at least two protein isoforms of the Double C2 protein, namely alpha (DOC2A) and beta (DOC2B), which contain two C2-like domains. DOC2A and DOC2B are encoded by different genes; these genes are at times confused with the unrelated DAB2 gene which was initially named DOC-2. DOC2B is expressed ubiquitously and is suggested to be involved in Ca(2+)-dependent intracellular vesicle trafficking in various types of cells. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003585" in other vectors (6)
SKU Description Size Price
RC218949L1 Lenti ORF clone of Human double C2-like domains, beta (DOC2B), Myc-DDK-tagged 10 ug
$757.00
RC218949L2 Lenti ORF clone of Human double C2-like domains, beta (DOC2B), mGFP tagged 10 ug
$757.00
RC218949L3 Lenti ORF clone of Human double C2-like domains, beta (DOC2B), Myc-DDK-tagged 10 ug
$757.00
RC218949L4 Lenti ORF clone of Human double C2-like domains, beta (DOC2B), mGFP tagged 10 ug
$757.00
RG218949 DOC2B (tGFP-tagged) - Human double C2-like domains, beta (DOC2B) 10 ug
$657.00
SC303353 DOC2B (untagged)-Human double C2-like domains, beta (DOC2B) 10 ug
$457.00

Plasmid Map for RC218949

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC218949
Circular map for RC218949

file-alt Citations

Distinct insulin granule subpopulations implicated in the secretory pathology of diabetes types 1 and 2
Kreutzberger, Kiessling, Doyle et al
Elife (2020) 9 DOI: 10.7554/eLife.62506
AI Summary: OriGene products contributed to this study by providing the anti-C-peptide antibody (Cat# TA325570), which was used to detect and analyze insulin granule subpopulations in β-cells under diabetic model conditions.
FigureFigureFigure
Doc2b Protects β-Cells Against Inflammatory Damage and Enhances Function
Aslamy, Oh, Olson et al
Diabetes (2018) 67 (7), 1332-1344 DOI: 10.2337/db17-1352
AI Summary: OriGene's pCMVhDoc2bmycDDK plasmid was used as the source of hDoc2b-mycDDK cDNA to generate adenovirus for overexpressing DOC2B in functional studies, enabling the investigation of DOC2B's protective role in β-cells.
Snippet: Cell culture, transfections, GSIS and binding assays. Human (h)Doc2b adenovirus was generated by insertion of the hDoc2b-mycDDK cDNA from the pCMVhDoc2bmycDDK plasmid (OriGene Technology, Inc., MD, USA) into the pAd5CMVmpA adenoviral vector. The
DNA Promoter Methylation Dependent Transcription of Double C2 Like Domain Beta (DOC2B) Gene Regulates Tumor Growth in Human Cervical Cancer
Kabekkodu, Bhat, Radhakrishnan et al
J. Biol. Chem. (2014)
AI Summary: OriGene’s DOC2B-pCMV6-Entry plasmid was used to overexpress the DOC2B gene in SiHa cervical cancer cells, enabling the study of its effects on tumor growth and cellular behavior in this research.
Snippet: Transfection and Selection of Stable DOC2B expressing clones-The DOC2B-pCMV6- Entry (Origene, USA) or empty vector was transfected into SiHa Cells using Lipofectamine 2000 (Invitrogen, USA) according to manufacturer's instruction. ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products