OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP21 (NM_022076) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC218231
DUSP21 (Myc-DDK-tagged)-Human dual specificity phosphatase 21 (DUSP21)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DUSP21 or NM_022076"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP21
Synonyms LMWDSP21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218231 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGCATCCGCGTCCTCCTTTTCATCATCTCAGGGTGTCCAGCAGCCCTCCATCTACAGCTTCTCCC
AAATAACCAGAAGCTTGTTTCTCAGCAATGGTGTGGCCGCCAACGACAAACTCCTTCTGTCCAGCAATCG
CATCACCGCCATTGTCAATGCCTCGGTGGAAGTGGTCAACGTATTCTTCGAGGGCATTCAGTACATAAAG
GTGCCTGTTACCGATGCTCGTGACTCGCGTCTCTACGACTTTTTTGACCCCATTGCTGATCTTATCCACA
CCATCGATATGAGGCAGGGCCGTACGCTGCTGCACTGCATGGCTGGAGTGAGCCGTTCCGCCTCACTGTG
CCTTGCGTACCTCATGAAATACCACTCCATGTCGCTGCTGGACGCCCATACATGGACCAAGTCGCGCCGC
CCCATCATCCGGCCCAACAACGGCTTTTGGGAACAGCTCATCAATTACGAATTCAAGCTGTTTAATAACA
ACACCGTGCGCATGATCAACTCGCCGGTAGGTAACATCCCTGACATCTATGAGAAGGACCTACGTATGAT
GATATCAATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218231 protein sequence
Red=Cloning site Green=Tags(s)

MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIK
VPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRR
PIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRMMISM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_022076
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022076.4
RefSeq Size 889 bp
RefSeq ORF 573 bp
Locus ID 63904
UniProt ID Q9H596
Cytogenetics Xp11.3
Protein Families Druggable Genome, Phosphatase
MW 21.5 kDa
Summary This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups from phosphotyrosine and phosphothreonine residues.provided by RefSeq, Mar 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_022076" in other vectors (6)
SKU Description Size Price
RC218231L1 Lenti ORF clone of Human dual specificity phosphatase 21 (DUSP21), Myc-DDK-tagged 10 ug
$600.00
RC218231L2 Lenti ORF clone of Human dual specificity phosphatase 21 (DUSP21), mGFP tagged 10 ug
$600.00
RC218231L3 Lenti ORF clone of Human dual specificity phosphatase 21 (DUSP21), Myc-DDK-tagged 10 ug
$600.00
RC218231L4 Lenti ORF clone of Human dual specificity phosphatase 21 (DUSP21), mGFP tagged 10 ug
$600.00
RG218231 DUSP21 (tGFP-tagged) - Human dual specificity phosphatase 21 (DUSP21) 10 ug
$489.00 $500.00
SC127867 DUSP21 (untagged)-Human dual specificity phosphatase 21 (DUSP21) 10 ug
$300.00

Plasmid Map for RC218231

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC218231
Circular map for RC218231

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products