OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCD5 (NM_024906) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC216929
SCD5 (Myc-DDK-tagged)-Human stearoyl-CoA desaturase 5 (SCD5), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA358837 SCD5 Antibody - C-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SCD5 or NM_024906"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCD5
Synonyms ACOD4; FADS4; HSCD5; SCD2; SCD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216929 representing NM_024906
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGGCCCGGCCACCGACGCGGGGAAGATCCCTTTCTGCGACGCCAAGGAAGAAATCCGTGCCGGGC
TCGAAAGCTCTGAGGGCGGCGGCGGCCCGGAGAGGCCAGGCGCGCGCGGGCAGCGGCAGAACATCGTCTG
GAGGAATGTCGTCCTGATGAGCTTGCTCCACTTGGGGGCCGTGTACTCCCTGGTGCTCATCCCCAAAGCC
AAGCCACTCACTCTGCTCTGGGCCTACTTCTGCCTCCTCCTGGCCGCTCTGGGTGTGACAGCTGGTGCCC
ATCGCTTGTGGAGCCACAGGTCCTACCGGGCCAAGCTGCCTCTGAGGATATTTCTGGCTGTCGCCAACTC
CATGGCTTTCCAGAATGACATCTTCGAGCGGTCCAGGGACCACCGAGCCCACCACAAGTACTCAGAGACG
GATGCTGACCCCCACAATGCCCGCCGGGGCTTCTTCTTCTCCCATATTGGGTGGCTGTTTGTTCGCAAGC
ATCGAGATGTTATTGAGAAGGGGAGAAAGCTTGACGTCACTGACCTGCTTGCTGATCCTGTGGTCCGGAT
CCAGAGAAATACACAGCACATCCAGAAAGAAGGAAGAGCTCTCAATCAAGAGGCAGCGTGTGAGATGCTT
CGTGAGTGGCATCAAGGGCATATATTGAAAGTCACCCTTCCCGGATTACACATTTTAGCTTTGTTACATA
CTCATTGTAACCACTCCGAAAAGTGCTGCTTGATGCTGCGTGCTCTTTCTGTGTCCCTGGAGGTATTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC216929 representing NM_024906
Red=Cloning site Green=Tags(s)

MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKA
KPLTLLWAYFCLLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFERSRDHRAHHKYSET
DADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRNTQHIQKEGRALNQEAACEML
REWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024906
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024906.1, NP_079182.1
RefSeq Size 2021 bp
RefSeq ORF 771 bp
Locus ID 79966
UniProt ID Q86SK9, Q86SK9-2
Cytogenetics 4q21.22
Domains FA_desaturase
Protein Families Transmembrane
Protein Pathways Biosynthesis of unsaturated fatty acids, PPAR signaling pathway
MW 28.8 kDa
Summary Stearoyl-CoA desaturase (SCD; EC 1.14.99.5) is an integral membrane protein of the endoplasmic reticulum that catalyzes the formation of monounsaturated fatty acids from saturated fatty acids. SCD may be a key regulator of energy metabolism with a role in obesity and dislipidemia. Four SCD isoforms, Scd1 through Scd4, have been identified in mouse. In contrast, only 2 SCD isoforms, SCD1 (MIM 604031) and SCD5, have been identified in human. SCD1 shares about 85% amino acid identity with all 4 mouse SCD isoforms, as well as with rat Scd1 and Scd2. In contrast, SCD5 shares limited homology with the rodent SCDs and appears to be unique to primates (Wang et al., 2005 PubMed 15907797).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024906" in other vectors (4)
SKU Description Size Price
RC216929L3 Lenti ORF clone of Human stearoyl-CoA desaturase 5 (SCD5), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC216929L4 Lenti ORF clone of Human stearoyl-CoA desaturase 5 (SCD5), transcript variant 2, mGFP tagged 10 ug
$600.00
RG216929 SCD5 (tGFP-tagged) - Human stearoyl-CoA desaturase 5 (SCD5), transcript variant 2 10 ug
$500.00
SC312669 SCD5 (untagged)-Human stearoyl-CoA desaturase 5 (SCD5), transcript variant 2 10 ug
$330.00

Plasmid Map for RC216929

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC216929
Circular map for RC216929

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products