OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMS1 (PYCARD) (NM_013258) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC215592
PYCARD (Myc-DDK-tagged)-Human PYD and CARD domain containing (PYCARD), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA800081 PYCARD (TMS1) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TMS1 or NM_013258"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMS1
Synonyms ASC; CARD5; TMS; TMS-1; TMS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215592 representing NM_013258
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCGCGCGCGCGACGCCATCCTGGATGCGCTGGAGAACCTGACCGCCGAGGAGCTCAAGAAGTTCA
AGCTGAAGCTGCTGTCGGTGCCGCTGCGCGAGGGCTACGGGCGCATCCCGCGGGGCGCGCTGCTGTCCAT
GGACGCCTTGGACCTCACCGACAAGCTGGTCAGCTTTTACCTGGAGACCTACGGCGCCGAGCTCACCGCT
AACGTGCTGCGCGACATGGGCCTGCAGGAGATGGCCGGGCAGCTGCAGGCGGCCACGCACCAGGGCTCTG
GAGCCGCGCCAGCTGGGATCCAGGCCCCTCCTCAGTCGGCAGCCAAGCCAGGCCTGCACTTTATAGACCA
GCACCGGGCTGCGCTTATCGCGAGGGTCACAAACGTTGAGTGGCTGCTGGATGCTCTGTACGGGAAGGTC
CTGACGGATGAGCAGTACCAGGCAGTGCGGGCCGAGCCCACCAACCCAAGCAAGATGCGGAAGCTCTTCA
GTTTCACACCAGCCTGGAACTGGACCTGCAAGGACTTGCTCCTCCAGGCCCTAAGGGAGTCCCAGTCCTA
CCTGGTGGAGGACCTGGAGCGGAGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC215592 representing NM_013258
Red=Cloning site Green=Tags(s)

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA
NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV
LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013258
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013258.5
RefSeq Size 936 bp
RefSeq ORF 588 bp
Locus ID 29108
UniProt ID Q9ULZ3
Cytogenetics 16p11.2
Domains PAAD_DAPIN
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
MW 21.4 kDa
Summary This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_013258" in other vectors (6)
SKU Description Size Price
RC215592L1 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215592L2 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, mGFP tagged 10 ug
$600.00
RC215592L3 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215592L4 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, mGFP tagged 10 ug
$600.00
RG215592 PYCARD (tGFP-tagged) - Human PYD and CARD domain containing (PYCARD), transcript variant 1 10 ug
$489.00 $500.00
SC115313 PYCARD (untagged)-Human PYD and CARD domain containing (PYCARD), transcript variant 1 10 ug
$300.00

Plasmid Map for RC215592

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC215592
Circular map for RC215592

file-alt Citations

Prdx4 limits caspase‐1 activation and restricts inflammasome‐mediated signaling by extracellular vesicles
Lipinski, Pfeuffer, Arnold et al
EMBO J. (2019) 38 (20), e101266 DOI: 10.15252/embj.2018101266
AI Summary: In this study, the mouse anti-DDK antibody (TA50011-100) from OriGene was used to detect DDK-tagged proteins, facilitating the analysis of protein expression and interactions involved in inflammasome-mediated signaling.
Snippet: antibody to ASC (AG‐25B‐0067;AdipoGen), rabbit antibody to CD63 (EXOAB‐CD63A‐1;SBI System Bioscience), mouse antibody to β‐actin (A‐5441;Sigma), mouse antibody to DDK (TA50011‐100;Origene), rabbit antibody to turboGFP (AB513;evrogen). All HRP‐conjugated secondary antibodies were obtained from TH Geyer. …
WB ELISA
DPP8/9 inhibitors are universal activators of functional NLRP1 alleles
Gai, Okondo, Rao et al
Cell Death Dis (2019) 10 (8), 587 DOI: 10.1038/s41419-019-1817-5
AI Summary: In this study, OriGene products—specifically cDNAs for mouse Gsdmd, mouse Casp1, and mouse Pycard—were used to investigate the activation of NLRP1 inflammasomes by DPP8/9 inhibitors.
Snippet: All Nlrp1 cDNAs were subcloned into modified pLEX_307 vectors with N-terminal V5-GFP or C-terminal FLAG tags using Gateway technology (Thermo Fisher Scientific). cDNAs for mouse Gsdmd, mouse Casp1, and mouse Pycard were purchased from Origene
FigureFigureFigure
Biallelic hypomorphic mutations in a linear deubiquitinase define otulipenia, an early-onset autoinflammatory disease
Zhou, Yu, Demirkaya et al
PNAS (2016)
Cited by 285
AI Summary: OriGene products, including WT OTULIN plasmid (RC224840), mutant OTULIN plasmids, RIPK1 (HW1506051), NEMO (SC117828), TNFRSF1A (RC204008), ASC (RC215592), and HOIP (TA329873) plasmids, were used in this study to investigate the functional consequences of OTULIN mutations in the pathogenesis of otulipenia.
Snippet: The WT OTULIN plasmid (RC224840) was from Origene, and the three mutant OTULIN plasmids (Y244C, L272P, and G174Dfs*2) were constructed by site-directed mutagenesis. Plasmids for RIPK1 (HW1506051), NEMO (SC117828), TNFRSF1A (RC204008), and ASC (RC215592) were from Origene;plasmids for SHARPIN (#50014), HOIP (#50015), and HOIL-1 (#50016) were from Addgene;phospho-IKKα/β (#2697), IKKα (#11930), IκBα (#4814, #9242), phospho-IκBα (#2859), TNFR1 (#3736), RIP (#3493), phospho-p38 MAPK (#4511), phospho-SAPK/JNK (#4668), SAPK/JNK (#9252), p38 MAPK (#8690), SHARPIN (#12541), OTULIN (#14127), β-actin (#4970), and HSP90 (#4874) were from Cell Signaling;HOIP (TA329873) was from Origene;polyubiquitin (sc-271289) was from Santa Cruz;linear polyubiquitin (AB130) was from Lifesensors
WB
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products