TMS1 (PYCARD) (NM_013258) Human Tagged ORF Clone

SKU
RG215592
PYCARD (tGFP-tagged) - Human PYD and CARD domain containing (PYCARD), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMS1
Synonyms ASC; CARD5; TMS; TMS-1; TMS1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG215592 representing NM_013258
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCGCGCGCGCGACGCCATCCTGGATGCGCTGGAGAACCTGACCGCCGAGGAGCTCAAGAAGTTCA
AGCTGAAGCTGCTGTCGGTGCCGCTGCGCGAGGGCTACGGGCGCATCCCGCGGGGCGCGCTGCTGTCCAT
GGACGCCTTGGACCTCACCGACAAGCTGGTCAGCTTTTACCTGGAGACCTACGGCGCCGAGCTCACCGCT
AACGTGCTGCGCGACATGGGCCTGCAGGAGATGGCCGGGCAGCTGCAGGCGGCCACGCACCAGGGCTCTG
GAGCCGCGCCAGCTGGGATCCAGGCCCCTCCTCAGTCGGCAGCCAAGCCAGGCCTGCACTTTATAGACCA
GCACCGGGCTGCGCTTATCGCGAGGGTCACAAACGTTGAGTGGCTGCTGGATGCTCTGTACGGGAAGGTC
CTGACGGATGAGCAGTACCAGGCAGTGCGGGCCGAGCCCACCAACCCAAGCAAGATGCGGAAGCTCTTCA
GTTTCACACCAGCCTGGAACTGGACCTGCAAGGACTTGCTCCTCCAGGCCCTAAGGGAGTCCCAGTCCTA
CCTGGTGGAGGACCTGGAGCGGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215592 representing NM_013258
Red=Cloning site Green=Tags(s)

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA
NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV
LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013258
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013258.3, NP_037390.2
RefSeq Size 936 bp
RefSeq ORF 588 bp
Locus ID 29108
UniProt ID Q9ULZ3
Cytogenetics 16p11.2
Domains PAAD_DAPIN
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
Summary This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TMS1 (PYCARD) (NM_013258) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215592 PYCARD (Myc-DDK-tagged)-Human PYD and CARD domain containing (PYCARD), transcript variant 1 10 ug
$300.00
RC215592L1 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215592L2 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, mGFP tagged 10 ug
$600.00
RC215592L3 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215592L4 Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, mGFP tagged 10 ug
$600.00
SC115313 PYCARD (untagged)-Human PYD and CARD domain containing (PYCARD), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.