OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TREX1 (NM_016381) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC214869
TREX1 (Myc-DDK-tagged)-Human three prime repair exonuclease 1 (TREX1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA306702 Rabbit Polyclonal TREX1 Antibody
100 ug
$640.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TREX1 or NM_016381"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TREX1
Synonyms AGS1; CRV; DRN3; HERNS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214869 representing NM_016381
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCCTGGAGCTCGCAGACAGGGCAGGATTGTGCAGGGAAGGCCTGAGATGTGCTTCTGCCCACCCC
CTACCCCACTCCCTCCCCTTCGGATCTTAACACTGGGCACTCACACACCCACCCCATGCTCCTCTCCAGG
CTCAGCAGCAGGTACGTACCCAACCATGGGCTCGCAGGCCCTGCCCCCGGGGCCCATGCAGACCCTCATC
TTTTTCGACATGGAGGCCACTGGCTTGCCCTTCTCCCAGCCCAAGGTCACGGAGCTGTGCCTGCTGGCTG
TCCACAGATGTGCCCTGGAGAGCCCCCCCACCTCTCAGGGGCCACCTCCCACAGTTCCTCCACCACCGCG
TGTGGTAGACAAGCTCTCCCTGTGTGTGGCTCCGGGGAAGGCCTGCAGCCCTGCAGCCAGCGAGATCACA
GGTCTGAGCACAGCTGTGCTGGCAGCGCATGGGCGTCAATGTTTTGATGACAACCTGGCCAACCTGCTCC
TAGCCTTCCTGCGGCGCCAGCCACAGCCCTGGTGCCTGGTGGCACACAATGGTGACCGCTACGACTTCCC
CCTGCTCCAAGCAGAGCTGGCTATGCTGGGCCTCACCAGTGCTCTGGATGGTGCCTTCTGTGTGGATAGC
ATCACTGCGCTGAAGGCCCTGGAGCGAGCAAGCAGCCCCTCAGAACACGGCCCAAGGAAGAGCTATAGCC
TAGGCAGCATCTACACTCGCCTGTATGGGCAGTCCCCTCCAGACTCGCACACGGCTGAGGGTGATGTCCT
GGCCCTGCTCAGCATCTGTCAGTGGAGACCACAGGCCCTGCTGCGGTGGGTGGATGCTCACGCCAGGCCT
TTCGGCACCATCAGGCCCATGTATGGGGTCACAGCCTCTGCTAGGACCAAGCCAAGACCATCTGCTGTCA
CAACCACTGCACACCTGGCCACAACCAGGAACACTAGTCCCAGCCTTGGAGAGAGCAGGGGTACCAAGGA
TCTTCCTCCAGTGAAGGACCCTGGAGCCCTATCCAGGGAGGGGCTGCTGGCCCCACTGGGTCTGCTGGCC
ATCCTGACCTTGGCAGTAGCCACACTGTATGGACTATCCCTGGCCACACCTGGGGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC214869 representing NM_016381
Red=Cloning site Green=Tags(s)

MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLI
FFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEIT
GLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDS
ITALKALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARP
FGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSREGLLAPLGLLA
ILTLAVATLYGLSLATPGE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016381
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016381.5
RefSeq Size 2216 bp
RefSeq ORF 1110 bp
Locus ID 11277
UniProt ID Q9NSU2
Cytogenetics 3p21.31
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytosolic DNA-sensing pathway
MW 38.7 kDa
Summary This gene encodes a nuclear protein with 3' exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree encephalitis, and other diseases of the immune system. Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016381" in other vectors (6)
SKU Description Size Price
RC214869L1 Lenti ORF clone of Human three prime repair exonuclease 1 (TREX1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC214869L2 Lenti ORF clone of Human three prime repair exonuclease 1 (TREX1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC214869L3 Lenti ORF clone of Human three prime repair exonuclease 1 (TREX1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC214869L4 Lenti ORF clone of Human three prime repair exonuclease 1 (TREX1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG214869 TREX1 (tGFP-tagged) - Human three prime repair exonuclease 1 (TREX1), transcript variant 1 10 ug
$489.00 $657.00
SC304415 TREX1 (untagged)-Human three prime repair exonuclease 1 (TREX1), transcript variant 1 10 ug
$457.00

Plasmid Map for RC214869

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC214869
Circular map for RC214869

file-alt Citations

TREX1 is expressed by microglia in normal human brain and increases in regions affected by ischemia
Kothari, Kolar, Jen et al
Brain Pathol. (2018)
AI Summary: In this study, OriGene’s human TREX1 cDNA (variants 1 and 4) was used to create plasmid constructs for cell culture and transfection experiments, enabling the researchers to analyze TREX1 expression and function in human brain tissues.
Snippet: Page 6. Accepted Article This article is protected by copyright. All rights reserved. Plasmid construct, cell culture and transfection The cDNA for human TREX1 was obtained from OriGene Technologies (Rockville, MD) and variants 1 and 4 (Fig
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products