OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Estrogen Receptor 1 (ESR1) (NM_000125) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC213277
ESR1 (Myc-DDK-tagged)-Human estrogen receptor 1 (ESR1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $831.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA503759 ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI1B1 (formerly 1B1) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Estrogen Receptor 1 or NM_000125"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Estrogen Receptor 1
Synonyms ER; Era; ESR; ESRA; ESTRR; NR3A1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213277 representing NM_000125.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGACCATGACCCTCCACACCAAAGCATCTGGGATGGCCCTACTGCATCAGATCCAAGGGAACGAGCTG
GAGCCCCTGAACCGTCCGCAGCTCAAGATCCCCCTGGAGCGGCCCCTGGGCGAGGTGTACCTGGACAGC
AGCAAGCCCGCCGTGTACAACTACCCCGAGGGCGCCGCCTACGAGTTCAACGCCGCGGCCGCCGCCAAC
GCGCAGGTCTACGGTCAGACCGGCCTCCCCTACGGCCCCGGGTCTGAGGCTGCGGCGTTCGGCTCCAAC
GGCCTGGGGGGTTTCCCCCCACTCAACAGCGTGTCTCCGAGCCCGCTGATGCTACTGCACCCGCCGCCG
CAGCTGTCGCCTTTCCTGCAGCCCCACGGCCAGCAGGTGCCCTACTACCTGGAGAACGAGCCCAGCGGC
TACACGGTGCGCGAGGCCGGCCCGCCGGCATTCTACAGGCCAAATTCAGATAATCGACGCCAGGGTGGC
AGAGAAAGATTGGCCAGTACCAATGACAAGGGAAGTATGGCTATGGAATCTGCCAAGGAGACTCGCTAC
TGTGCAGTGTGCAATGACTATGCTTCAGGCTACCATTATGGAGTCTGGTCCTGTGAGGGCTGCAAGGCC
TTCTTCAAGAGAAGTATTCAAGGACATAACGACTATATGTGTCCAGCCACCAACCAGTGCACCATTGAT
AAAAACAGGAGGAAGAGCTGCCAGGCCTGCCGGCTCCGCAAATGCTACGAAGTGGGAATGATGAAAGGT
GGGATACGAAAAGACCGAAGAGGAGGGAGAATGTTGAAACACAAGCGCCAGAGAGATGATGGGGAGGGC
AGGGGTGAAGTGGGGTCTGCTGGAGACATGAGAGCTGCCAACCTTTGGCCAAGCCCGCTCATGATCAAA
CGCTCTAAGAAGAACAGCCTGGCCTTGTCCCTGACGGCCGACCAGATGGTCAGTGCCTTGTTGGATGCT
GAGCCCCCGATACTCTATTCCGAGTATGATCCTACCAGACCCTTCAGTGAAGCTTCGATGATGGGCTTA
CTGACCAACCTGGCAGACAGGGAGCTGGTTCACATGATCAACTGGGCGAAGAGGGTGCCAGGCTTTGTG
GATTTGACCCTCCATGATCAGGTCCACCTTCTAGAATGTGCCTGGCTAGAGATCCTGATGATTGGTCTC
GTCTGGCGCTCCATGGAGCACCCAGGGAAGCTACTGTTTGCTCCTAACTTGCTCTTGGACAGGAACCAG
GGAAAATGTGTAGAGGGCATGGTGGAGATCTTCGACATGCTGCTGGCTACATCATCTCGGTTCCGCATG
ATGAATCTGCAGGGAGAGGAGTTTGTGTGCCTCAAATCTATTATTTTGCTTAATTCTGGAGTGTACACA
TTTCTGTCCAGCACCCTGAAGTCTCTGGAAGAGAAGGACCATATCCACCGAGTCCTGGACAAGATCACA
GACACTTTGATCCACCTGATGGCCAAGGCAGGCCTGACCCTGCAGCAGCAGCACCAGCGGCTGGCCCAG
CTCCTCCTCATCCTCTCCCACATCAGGCACATGAGTAACAAAGGCATGGAGCATCTGTACAGCATGAAG
TGCAAGAACGTGGTGCCCCTCTATGACCTGCTGCTGGAGATGCTGGACGCCCACCGCCTACATGCGCCC
ACTAGCCGTGGAGGGGCATCCGTGGAGGAGACGGACCAAAGCCACTTGGCCACTGCGGGCTCTACTTCA
TCGCATTCCTTGCAAAAGTATTACATCACGGGGGAGGCAGAGGGTTTCCCTGCCACGGTC
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC213277
Blue=ORF Red=Cloning site Green=Tag(s)

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAAN
AQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSG
YTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKA
FFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEG
RGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGL
LTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQ
GKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKIT
DTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAP
TSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
myc-FLAG tag

Recombinant protein using RC213277 also available, TP313277
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000125
ORF Size 1785 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 6456 bp
RefSeq ORF 1788 bp
Locus ID 2099
UniProt ID P03372
Cytogenetics 6q25.1-q25.2
Domains HOLI, Oest_recep, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
MW 66.2 kDa
Summary This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain. provided by RefSeq, Jul 2020
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000125" in other vectors (6)
SKU Description Size Price
RC213277L1 Lenti ORF clone of Human estrogen receptor 1 (ESR1), transcript variant 1, Myc-DDK-tagged 10 ug
$1,131.00
RC213277L2 Lenti ORF clone of Human estrogen receptor 1 (ESR1), transcript variant 1, mGFP tagged 10 ug
$1,131.00
RC213277L3 Lenti ORF clone of Human estrogen receptor 1 (ESR1), transcript variant 1, Myc-DDK-tagged 10 ug
$1,131.00
RC213277L4 Lenti ORF clone of Human estrogen receptor 1 (ESR1), transcript variant 1, mGFP tagged 10 ug
$1,131.00
RG213277 ESR1 (tGFP-tagged) - Human estrogen receptor 1 (ESR1), transcript variant 1 10 ug
$489.00 $1,031.00
SC125287 ESR1 (untagged)-Human estrogen receptor 1 (ESR1), transcript variant 1 10 ug
$832.00

Plasmid Map for RC213277

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC213277
Circular map for RC213277

file-alt Citations

The crosstalk between IGF-1R and ER-α in the proliferation and anti-inflammation of nucleus pulposus cells
Chen, Zhang, Zhu et al
Eur Rev Med Pharmacol Sci (2020) 24 (11), 5886-5894 DOI: 10.26355/eurrev_202006_21481
Cited by 11
AI Summary: OriGene products, specifically the human tagged ORF clones for IGF-1R (NM_000875), ER-α (NM_000125), and the untagged clone (null, AK098156), were used for plasmid transfection to upregulate IGF-1R and ER-α expression in nucleus pulposus cells, enabling the study of their crosstalk in cell proliferation and inflammation.
Snippet: Plasmid Transfection NP cells were transfected by plasmid (hu- man tagged ORF clone) targeting IGF-1R (NM_000875), ER-α (NM_000125) or Untagged Clone (null, AK098156) purchased from OriGene Technologies (Rockville, MD, USA) using Turbo- Fectin regent;- Plasmid Transfection NP cells were transfected by plasmid (hu- man tagged ORF clone) targeting IGF-1R (NM_000875), ER-α (NM_000125) or Untagged Clone (null, AK098156) purchased from OriGene Technologies (Rockville, MD, USA) using Turbo- Fectin regent
ERα upregulates the expression of long non-coding RNA LINC00472 which suppresses the phosphorylation of NF-κB in breast cancer
Wang, Katsaros, Biglia et al
Breast Cancer Res. Treat. (2019) 175 (2), 353-368 DOI: 10.1007/s10549-018-05108-5
AI Summary: OriGene products, specifically the pCMV-ESR1 plasmid (#RC213277) and the pCMV-vector (#PS100001), were used to manipulate ERα expression in cell experiments, enabling the study of its regulatory effect on LINC00472 in breast cancer.
Snippet: Plasmids (pCMV-ESR1) with and without the full-length of human ESR1 (NM_000125, #RC213277) and (pCMV-vector, #PS100001), respectively, were purchased from Origene Technologies, and the plas- mids were transfected into the 293T cells and breast cancer
Estrogen receptor regulates hormone-induced growth arrest in a luminal A like breast cancer model
Haddon, Hu, Jabbari et al
bioRxiv (2018)
Snippet: ESR1 was amplified from ESR1 (NM 000125) human cDNA ORF clone (OriGene, Rockville, MD) by PCR using primers 5'- ATCCGCTAGCGCCACCATGACCATGACCCTCCA CACCAAA-3' and 5'- TCCGGAGGCTCGCGACCGTGGCAGGGAAACCCTCTGC-3'. The human View as HTML
Polyfluorinated iodine alkanes regulated distinct breast cancer cell progression through binding with estrogen receptor alpha or beta isoforms
Song, Liu, Sun et al
Environ. Pollut. (2018) 239, 300-307 DOI: 10.1016/j.envpol.2018.04.037
AI Summary: OriGene contributed purified recombinant human ERα and ERβ proteins, which were used to study the binding affinities of polyfluorinated iodine alkanes to estrogen receptor isoforms in breast cancer cell models.
Snippet: The series of working solutions were freshly diluted with sterile cell exposure medium, and the final DMSO concentration was less than 0.5%. The purified recombinant human ERα and ERβ proteins were obtained from OriGene Technologies Inc
ER alpha binding by transcription factors NFIB and YBX1 enables FGFR2 signalling to modulate estrogen responsiveness in breast cancer
Campbell, Castro, deOliveira et al
Cancer Res. (2017)
AI Summary: OriGene products RC213277 (ESR1), RC231275 (NFIB), and RC209835 (YBX1) provided the gene templates used to generate expression constructs for studying protein interactions central to the paper’s investigation of estrogen receptor signaling in breast cancer.
Snippet: The ESR1-Cerulean construct was 174 created by amplifying the gene encoding ESR1 (from RC213277;OriGene) and 175 constructs were created similarly (from plasmids RC231275 (NFIB) and RC209835 178 (YBX1);OriGene)
RIZ1 is regulated by estrogen and suppresses tumor progression in endometrial cancer
Yang, Ren, Jiang et al
Biochem. Biophys. Res. Commun. (2017)
AI Summary: In this study, OriGene products—including the RIZ1-expressing plasmid (pEGFP-C1-RIZ1), ERα shRNA (sh-ERα), and ERα-expressing vector (ex-ERα)—were used to manipulate gene expression in endometrial cancer cells, enabling the researchers to investigate the regulatory relationship between estrogen, RIZ1, and tumor progression.
Snippet: The RIZ1-expressing plasmid (pEGFP-C1-RIZ1) and its control vector, ERα shRNA (sh-ERα) and ERa-expressing vector (ex-ERα) (OriGene Technologies, BeiJing), the siRNA duplex of RIZ1 (5′-AACUGGCUGCGAUAUGUGAAUdTdT-3′) were transfected using ... All 3 versions Cite SaveSaving
Showing 1-6 of 12 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products