OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB5C (NM_201434) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210698
RAB5C (Myc-DDK-tagged)-Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RAB5C or NM_201434"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB5C
Synonyms L1880; RAB5CL; RAB5L; RABL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210698 representing NM_201434
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGTCGGGGAGGCGCAGCACGACCCAATGGACCAGCTGCTGGGAACAAGATCTGTCAATTTAAGC
TGGTTCTGCTGGGGGAGTCTGCGGTAGGCAAATCCAGCCTCGTCCTCCGCTTTGTCAAGGGACAGTTTCA
CGAGTACCAGGAGAGCACAATTGGAGCGGCCTTCCTCACACAGACTGTCTGCCTGGATGACACAACAGTC
AAGTTTGAGATCTGGGACACAGCTGGACAGGAGCGGTATCACAGCCTGGCCCCCATGTACTATCGGGGGG
CCCAGGCTGCCATCGTGGTCTATGACATCACCAACACAGATACATTTGCACGGGCCAAGAACTGGGTGAA
GGAGCTACAGAGGCAGGCCAGCCCCAACATCGTCATTGCACTCGCGGGTAACAAGGCAGACCTGGCCAGC
AAGAGAGCCGTGGAATTCCAGGAAGCACAAGCCTATGCAGACGACAACAGTTTGCTGTTCATGGAGACAT
CAGCAAAGACTGCAATGAACGTGAACGAAATCTTCATGGCAATAGCTAAGAAGCTTCCCAAGAACGAGCC
CCAGAATGCAACTGGTGCTCCAGGCCGAAACCGAGGTGTGGACCTCCAGGAGAACAACCCAGCCAGCCGG
AGCCAGTGCTGCAGCAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s)

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV
KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS
KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
SQCCSN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_201434
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_201434.3
RefSeq Size 1791 bp
RefSeq ORF 651 bp
Locus ID 5878
UniProt ID P51148
Cytogenetics 17q21.2
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 23.3 kDa
Summary Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 PubMed 8646882).supplied by OMIM, Nov 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_201434" in other vectors (6)
SKU Description Size Price
RC210698L1 Lenti ORF clone of Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210698L2 Lenti ORF clone of Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210698L3 Lenti ORF clone of Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210698L4 Lenti ORF clone of Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210698 RAB5C (tGFP-tagged) - Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 10 ug
$489.00 $500.00
SC322014 RAB5C (untagged)-Human RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 10 ug
$300.00

Plasmid Map for RC210698

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210698
Circular map for RC210698

file-alt Citations

Endosomal Escape of ASOs Internalized by Stabilin Receptors Is Regulated by Rab5C and EEA1 During Endosomal Maturation
Miller, Wan, Seth et al
Nucleic Acid Ther (2018)
AI Summary: OriGene’s Rab5 plasmid (NM_201434) was used for Rab5C overexpression in cell experiments to investigate its role in the endosomal trafficking and escape of antisense oligonucleotides.
Snippet: Rab5C overexpression and Western blot analysis The Rab5 plasmid (OriGene NM_201434) was transiently transfected into 190-kDa HARE-overexpressing cells using Lipofectamine 2000 under predetermined optimal conditions
N-cadherin regulates cell migration through a Rab5-dependent temporal control of macropinocytosis
Wen, Wang, Chiu et al
Traffic (2016)
Cited by 12
AI Summary: OriGene products, specifically the Human Rab5b (RC208529) and Rab5c (RC210698) myc-DDK tagged plasmids, were used in this study to investigate the role of Rab5 in N-cadherin-mediated regulation of macropinocytosis and cell migration.
Snippet: Academia Sinica, Taipei, Taiwan). Rab7-mRFP plasmid was purchased from Addgene (14436). Human Rab5b and Rab5c with myc-DDK tag were purchased from OriGene (RC208529 &RC210698). To generate the Rab5a ... Cite SaveSaving
Identifizierung neuer Coregulatoren von SOX9 und RUNX2 in chondrogenen Progenitorzellen in der Osteoarthrose
Cingöz
Thesis (2015)
Snippet: pCMV6-DDX5-C-Myc-DDK Kan/Neo NM_004396 OriGene (Rockville, USA) pCMV6-HSPA8-C-Myc-DDK Kan/Neo NM_006597 OriGene (Rockville, USA) pCMV6-LASP1-C-Myc-DDK Kan/Neo NM_006148 OriGene (Rockville, USA) pCMV6-RAB5C-C-Myc-DDK Kan/Neo NM_201434 OriGene (Rockville, USA) pCMV6-SFPQ-C-Myc-DDK Kan/Neo NM_005066 OriGene (Rockville, USA) pCMV6-STMN1-C-Myc-DDK Kan/Neo NM_203401 OriGene (Rockville, USA) pCMV6-YWHAE-C-Myc-DDK Kan/Neo NM_006761 OriGene (Rockville, USA)
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products