OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRPR (NM_005314) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210362
GRPR (Myc-DDK-tagged)-Human gastrin-releasing peptide receptor (GRPR)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA321704 Anti-GRPR Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GRPR or NM_005314"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GRPR
Synonyms BB2; BB2R; BRS2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210362 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTAAATGACTGTTTCCTTCTGAACTTGGAGGTGGACCATTTCATGCACTGCAACATCTCCAGTC
ACAGTGCGGATCTCCCCGTGAACGATGACTGGTCCCACCCGGGGATCCTCTATGTCATCCCTGCAGTTTA
TGGGGTTATCATTCTGATAGGCCTCATTGGCAACATCACTTTGATCAAGATCTTCTGTACAGTCAAGTCC
ATGCGAAACGTTCCAAACCTGTTCATTTCCAGTCTGGCTTTGGGAGACCTGCTCCTCCTAATAACGTGTG
CTCCAGTGGATGCCAGCAGGTACCTGGCTGACAGATGGCTATTTGGCAGGATTGGCTGCAAACTGATCCC
CTTTATACAGCTTACCTCTGTTGGGGTGTCTGTCTTCACACTCACGGCGCTCTCGGCAGACAGATACAAA
GCCATTGTCCGGCCAATGGATATCCAGGCCTCCCATGCCCTGATGAAGATCTGCCTCAAAGCCGCCTTTA
TCTGGATCATCTCCATGCTGCTGGCCATTCCAGAGGCCGTGTTTTCTGACCTCCATCCCTTCCATGAGGA
AAGCACCAACCAGACCTTCATTAGCTGTGCCCCATACCCACACTCTAATGAGCTTCACCCCAAAATCCAT
TCTATGGCTTCCTTTCTGGTCTTCTACGTCATCCCACTGTCGATCATCTCTGTTTACTACTACTTCATTG
CTAAAAATCTGATCCAGAGTGCTTACAATCTTCCCGTGGAAGGGAATATACATGTCAAGAAGCAGATTGA
ATCCCGGAAGCGACTTGCCAAGACAGTGCTGGTGTTTGTGGGCCTGTTCGCCTTCTGCTGGCTCCCCAAT
CATGTCATCTACCTGTACCGCTCCTACCACTACTCTGAGGTGGACACCTCCATGCTCCACTTTGTCACCA
GCATCTGTGCCCGCCTCCTGGCCTTCACCAACTCCTGCGTGAACCCCTTTGCCCTCTACCTGCTGAGCAA
GAGTTTCAGGAAACAGTTCAACACTCAGCTGCTCTGTTGCCAGCCTGGCCTGATCATCCGGTCTCACAGC
ACTGGAAGGAGTACAACCTGCATGACCTCCCTCAAGAGTACCAACCCCTCCGTGGCCACCTTTAGCCTCA
TCAATGGAAACATCTGTCACGAGCGGTATGTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210362 protein sequence
Red=Cloning site Green=Tags(s)

MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKIFCTVKS
MRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYK
AIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIH
SMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN
HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHS
TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005314
ORF Size 1152 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005314.1
RefSeq Size 2681 bp
RefSeq ORF 1155 bp
Locus ID 2925
UniProt ID P30550
Cytogenetics Xp22.2
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
MW 43.2 kDa
Summary Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005314" in other vectors (6)
SKU Description Size Price
RC210362L1 Lenti ORF clone of Human gastrin-releasing peptide receptor (GRPR), Myc-DDK-tagged 10 ug
$757.00
RC210362L2 Lenti ORF clone of Human gastrin-releasing peptide receptor (GRPR), mGFP tagged 10 ug
$757.00
RC210362L3 Lenti ORF clone of Human gastrin-releasing peptide receptor (GRPR), Myc-DDK-tagged 10 ug
$757.00
RC210362L4 Lenti ORF clone of Human gastrin-releasing peptide receptor (GRPR), mGFP tagged 10 ug
$757.00
RG210362 GRPR (tGFP-tagged) - Human gastrin-releasing peptide receptor (GRPR) 10 ug
$489.00 $657.00
SC116819 GRPR (untagged)-Human gastrin-releasing peptide receptor (GRPR) 10 ug
$457.00

Plasmid Map for RC210362

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210362
Circular map for RC210362

file-alt Citations

A human GRPr-transfected Ace-1 canine prostate cancer model in mice
Ding, Kothandaraman, Gong et al
Prostate (2016)
Cited by 8
AI Summary: OriGene’s human GRPr cDNA plasmid was used to stably transfect Ace-1 canine prostate cancer cells, enabling the creation of the Ace-1(huGRPr) cell line for evaluating GRPr-targeted imaging agents in this study.
Snippet: Cells were pas- saged twice per week. Establishment of GRPr stable expression cell line. Ace-1 cells expressing human GRPr (Ace-1huGRPr) were generated by transfecting Ace-1 cells with a plasmid containing human GRPr cDNA (OriGene Technologies, Inc., Rockville ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products