OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRPH2 (NM_000322) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210357
PRPH2 (Myc-DDK-tagged)-Human peripherin 2 (retinal degeneration, slow) (PRPH2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PRPH2 or NM_000322"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PRPH2
Synonyms AOFMD; AVMD; CACD2; DS; MDBS1; PRPH; rd2; RDS; RP7; TSPAN22
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210357 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTACTGAAAGTCAAGTTTGACCAGAAGAAGCGGGTCAAGTTGGCCCAAGGGCTCTGGCTCATGA
ACTGGTTCTCCGTGTTGGCTGGCATCATCATCTTCAGCCTAGGACTGTTCCTGAAGATTGGACTCCGAAA
GAGGAGCGATGTGATGAATAATTCTGAGAGCCATTTTGTGCCCAACTCATTGATAGGGATGGGGGTGCTA
TCCTGTGTCTTCAACTCGCTGGCTGGGAAGATCTGCTACGACGCCCTGGACCCAGCCAAGTATGCCAGAT
GGAAGCCCTGGCTGAAGCCGTACCTGGCTATCTGTGTCCTCTTCAACATCATCCTCTTCCTTGTGGCTCT
CTGCTGCTTTCTGCTTCGGGGCTCGCTGGAGAACACCCTGGGCCAAGGGCTCAAGAACGGCATGAAGTAC
TACCGGGACACAGACACCCCTGGCAGGTGTTTCATGAAGAAGACCATCGACATGCTGCAGATCGAGTTCA
AATGCTGCGGCAACAACGGTTTTCGGGACTGGTTTGAGATTCAGTGGATCAGCAATCGCTACCTGGACTT
TTCCTCCAAAGAAGTCAAAGATCGAATCAAGAGCAACGTGGATGGGCGGTACCTGGTGGACGGCGTCCCT
TTCAGCTGCTGCAATCCTAGCTCGCCACGGCCCTGCATCCAGTATCAGATCACCAACAACTCAGCACACT
ACAGTTACGACCACCAGACGGAGGAGCTCAACCTGTGGGTGCGTGGCTGCAGGGCTGCCCTGCTGAGCTA
CTACAGCAGCCTCATGAACTCCATGGGTGTCGTCACGCTCCTCATTTGGCTCTTCGAGGTGACCATTACA
ATTGGGCTGCGCTACCTACAGACGTCGCTGGATGGTGTGTCCAACCCCGAGGAATCTGAGAGCGAGAGCG
AGGGCTGGCTGCTGGAGAAGAGCGTGCCGGAGACCTGGAAGGCCTTTCTGGAGAGTGTGAAGAAGCTGGG
CAAGGGCAACCAGGTGGAAGCCGAGGGCGCAGGCGCAGGCCAGGCCCCAGAGGCTGGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210357 protein sequence
Red=Cloning site Green=Tags(s)

MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSDVMNNSESHFVPNSLIGMGVL
SCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKY
YRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVP
FSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVRGCRAALLSYYSSLMNSMGVVTLLIWLFEVTIT
IGLRYLQTSLDGVSNPEESESESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000322
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000322.5
RefSeq Size 3027 bp
RefSeq ORF 1041 bp
Locus ID 5961
UniProt ID P23942
Cytogenetics 6p21.1
Domains transmembrane4
Protein Families Druggable Genome, Transmembrane
Protein Pathways Amyotrophic lateral sclerosis (ALS)
MW 39.1 kDa
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein found in the outer segment of both rod and cone photoreceptor cells. It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. This protein is essential for disk morphogenesis. Defects in this gene are associated with both central and peripheral retinal degenerations. Some of the various phenotypically different disorders are autosomal dominant retinitis pigmentosa, progressive macular degeneration, macular dystrophy and retinitis pigmentosa digenic. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000322" in other vectors (6)
SKU Description Size Price
RC210357L1 Lenti ORF clone of Human peripherin 2 (retinal degeneration, slow) (PRPH2), Myc-DDK-tagged 10 ug
$757.00
RC210357L2 Lenti ORF clone of Human peripherin 2 (retinal degeneration, slow) (PRPH2), mGFP tagged 10 ug
$757.00
RC210357L3 Lenti ORF clone of Human peripherin 2 (retinal degeneration, slow) (PRPH2), Myc-DDK-tagged 10 ug
$757.00
RC210357L4 Lenti ORF clone of Human peripherin 2 (retinal degeneration, slow) (PRPH2), mGFP tagged 10 ug
$757.00
RG210357 PRPH2 (tGFP-tagged) - Human peripherin 2 (retinal degeneration, slow) (PRPH2) 10 ug
$489.00 $657.00
SC119972 PRPH2 (untagged)-Human peripherin 2 (retinal degeneration, slow) (PRPH2) 10 ug
$457.00

Plasmid Map for RC210357

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210357
Circular map for RC210357

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products