OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTRB2 (NM_001025200) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC209957
CTRB2 (Myc-DDK-tagged)-Human chymotrypsinogen B2 (CTRB2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CTRB2 or NM_001025200"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CTRB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209957 representing NM_001025200
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCCTCTGGCTCCTCTCCTGCTTCTCCCTTGTGGGGGCCGCCTTTGGCTGCGGGGTCCCCGCCA
TCCACCCTGTGCTCAGCGGCCTGTCCAGGATCGTGAATGGGGAGGACGCCGTCCCCGGCTCCTGGCCCTG
GCAGGTGTCCCTGCAGGACAAAACCGGCTTCCACTTCTGCGGGGGCTCCCTCATCAGCGAGGACTGGGTG
GTCACCGCTGCCCACTGCGGGGTCAGGACCTCCGACGTGGTCGTGGCTGGGGAGTTTGACCAGGGCTCTG
ACGAGGAGAACATCCAGGTCCTGAAGATCGCCAAGGTCTTCAAGAACCCCAAGTTCAGCATTCTGACCGT
GAACAATGACATCACCCTGCTGAAGCTGGCCACACCTGCCCGCTTCTCCCAGACAGTGTCCGCCGTGTGC
CTGCCCAGCGCCGACGACGACTTCCCCGCGGGGACACTGTGTGCCACCACAGGCTGGGGCAAGACCAAGT
ACAACGCCAACAAGACCCCTGACAAGCTGCAGCAGGCAGCCCTGCCCCTCCTGTCCAATGCCGAATGCAA
GAAGTCCTGGGGCAGGAGGATCACCGACGTGATGATCTGTGCCGGGGCCAGTGGCGTCTCCTCCTGCATG
GGTGACTCTGGAGGCCCCCTGGTCTGCCAGAAGGACGGAGCCTGGACCCTGGTGGGCATTGTGTCCTGGG
GCAGCCGCACCTGCTCTACCACCACGCCCGCTGTGTACGCCCGTGTCACCAAGCTCATACCCTGGGTGCA
GAAGATCCTGGCCGCCAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209957 representing NM_001025200
Red=Cloning site Green=Tags(s)

MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV
VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC
LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM
GDSGGPLVCQKDGAWTLVGIVSWGSRTCSTTTPAVYARVTKLIPWVQKILAAN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001025200
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001025200.2
RefSeq Size 936 bp
RefSeq ORF 792 bp
Locus ID 440387
UniProt ID Q6GPI1
Cytogenetics 16q23.1
Protein Families Druggable Genome, Transmembrane
MW 27.7 kDa
Summary This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This CTRB2 gene is located head-to-head with the related CTRB1 gene. Some human populations have an alternate haplotype which inverts a 16.6 Kb region containing portions of intron 1, exon 1, and the upstream sequence of the CTRB1 and CTRB2 genes. In this inversion haplotype exon 1 and flanking sequence is swapped in CTRB1 and CTRB2. This inversion is associated with differential gene expression and increased risk for chronic pancreatitis. The GRCh38 assembly represents the minor allele for SNP rs8048956 of the CTRB1 gene. SNP rs8048956 is diagnostic for this inversion. provided by RefSeq, Jan 2021
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001025200" in other vectors (4)
SKU Description Size Price
RC209957L3 Lenti ORF clone of Human chymotrypsinogen B2 (CTRB2), Myc-DDK-tagged 10 ug
$600.00
RC209957L4 Lenti ORF clone of Human chymotrypsinogen B2 (CTRB2), mGFP tagged 10 ug
$600.00
RG209957 CTRB2 (tGFP-tagged) - Human chymotrypsinogen B2 (CTRB2) 10 ug
$500.00
SC302364 CTRB2 (untagged)-Human chymotrypsinogen B2 (CTRB2) 10 ug
$330.00

Plasmid Map for RC209957

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC209957
Circular map for RC209957

file-alt Citations

A 584 bp deletion in CTRB2 inhibits chymotrypsin B2 activity and secretion and confers risk of pancreatic cancer
Jermusyk, Zhong, Connelly et al
Am J Hum Genet (2021) 108 (10), 1852-1865 DOI: 10.1016/j.ajhg.2021.09.002
Cited by 36
AI Summary: OriGene contributed to this study by providing the full-length CTRB2 open reading frame (ORF) with a Myc-FLAG (Myc-DDK) tag (cat. # RC209957), which was used to investigate the effects of the CTRB2 deletion on chymotrypsin B2 activity and secretion.
Snippet: …Chymotrypsin secretion. The full-length CTRB2 open reading frame (ORF) with a Myc-FLAG (Myc-DDK) tag was purchased from Origene (cat. # RC209957). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products