OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR45 (NM_007075) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC209654
WDR45 (Myc-DDK-tagged)-Human WD repeat domain 45 (WDR45), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
2 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365147 WDR45 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "WDR45 or NM_007075"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WDR45
Synonyms JM5; NBIA4; NBIA5; WDRX1; WIPI-4; WIPI4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209654 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTCAACAGCCACTTCGAGGAGTGACCAGCCTGCGTTTCAACCAAGACCAAAGCTGCTTTTGCTGCG
CCATGGAGACAGGTGTGCGCATCTACAACGTGGAGCCCTTGATGGAGAAGGGGCATCTGGACCACGAGCA
GGTGGGCAGCATGGGCTTGGTGGAGATGCTGCACCGCTCCAACCTTCTGGCCTTGGTGGGCGGTGGTAGT
AGTCCCAAGTTCTCAGAGATCTCAGCAGTGCTGATCTGGGACGATGCCCGGGAGGGCAAGGACTCCAAGG
AGAAGCTGGTGCTGGAGTTCACCTTCACCAAGCCAGTGCTTTCTGTGCGCATGCGCCATGACAAGATCGT
GATCGTGCTGAAGAACCGCATCTATGTGTACTCCTTCCCCGACAATCCCCGAAAGCTGTTTGAGTTTGAT
ACCCGGGACAACCCCAAGGGGCTCTGTGACCTCTGCCCCAGCCTGGAGAAGCAACTGCTAGTGTTCCCGG
GACACAAGTGTGGGAGTCTGCAACTTGTGGACCTGGCGAGCACAAAGCCTGGCACCTCGTCTGCTCCATT
CACGATCAATGCACATCAGAGTGACATAGCCTGTGTGTCTCTAAACCAGCCAGGCACTGTAGTGGCCTCA
GCCTCCCAGAAGGGTACCCTTATTCGCCTCTTTGACACACAATCCAAGGAGAAACTGGTGGAGCTGCGCC
GAGGCACTGACCCTGCCACCCTCTACTGCATTAACTTCAGCCACGACTCCTCCTTCCTCTGCGCTTCCAG
TGATAAGGGTACTGTCCATATCTTTGCTCTCAAGGATACCCGCCTCAACCGCCGCTCCGCGCTGGCTCGC
GTGGGCAAGGTGGGGCCTATGATTGGGCAGTACGTGGACTCTCAGTGGAGCCTGGCGAGCTTCACTGTGC
CTGCTGAGTCAGCTTGCATCTGCGCCTTCGGTCGCAATACTTCCAAGAACGTCAACTCTGTCATTGCCAT
CTGCGTAGATGGGACCTTCCACAAATATGTCTTCACTCCTGATGGAAACTGCAACAGAGAGGCTTTCGAC
GTGTACCTTGACATCTGTGATGATGATGACTTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209654 protein sequence
Red=Cloning site Green=Tags(s)

MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGS
SPKFSEISAVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFD
TRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSAPFTINAHQSDIACVSLNQPGTVVAS
ASQKGTLIRLFDTQSKEKLVELRRGTDPATLYCINFSHDSSFLCASSDKGTVHIFALKDTRLNRRSALAR
VGKVGPMIGQYVDSQWSLASFTVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFD
VYLDICDDDDF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007075
ORF Size 1083 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007075.3, NP_009006.2
RefSeq Size 1925 bp
RefSeq ORF 1086 bp
Locus ID 11152
UniProt ID Q9Y484
Cytogenetics Xp11.23
Domains WD40
MW 39.9 kDa
Summary This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene has a pseudogene at chromosome 4q31.3. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity and full-length nature of some variants have not been determined. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007075" in other vectors (7)
SKU Description Size Price
RC209654L1 Lenti ORF clone of Human WD repeat domain 45 (WDR45), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC209654L2 Lenti ORF clone of Human WD repeat domain 45 (WDR45), transcript variant 1, mGFP tagged 10 ug
$757.00
RC209654L3 Lenti ORF clone of Human WD repeat domain 45 (WDR45), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC209654L4 Lenti ORF clone of Human WD repeat domain 45 (WDR45), transcript variant 1, mGFP tagged 10 ug
$757.00
RG209654 WDR45 (tGFP-tagged) - Human WD repeat domain 45 (WDR45), transcript variant 1 10 ug
$489.00 $657.00
SC115710 WDR45 (untagged)-Human WD repeat domain 45 (WDR45), transcript variant 1 10 ug
$457.00
SC321010 WDR45 (untagged)-Human WD repeat domain 45 (WDR45), transcript variant 1 10 ug
$457.00

Plasmid Map for RC209654

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC209654
Circular map for RC209654

file-alt Citations

A neurodegeneration gene, WDR45, links impaired ferritinophagy to iron accumulation
Aring, Choi, Kopera et al
J Neurochem (2021)
Cited by 38
AI Summary: In this study, the MYC-FLAG-tagged human WDR45 plasmid (OriGene, RC209654) was used to investigate the role of WDR45 in ferritinophagy and iron accumulation in neurodegeneration models.
Snippet: The MYC-FLAG-tagged human WDR45 plasmid was purchased from Origene (RC209654). The dual-tagged mCherry-GFPLC3 plasmid was procured from Addgene (123230;deposited by Robin Ketteler). For small interfering RNA (siRNA)-mediated gene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products