OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WNT7B (NM_058238) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207691
WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA344089 Rabbit Polyclonal Anti-WNT7B Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "WNT7B or NM_058238"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WNT7B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207691 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAGAAACTTTCGCAAGTGGATTTTCTACGTGTTTCTCTGCTTTGGCGTCCTGTACGTGAAGCTCG
GAGCACTGTCATCCGTGGTGGCCCTGGGAGCCAACATCATCTGCAACAAGATTCCTGGCCTAGCCCCGCG
GCAGCGTGCCATCTGCCAGAGTCGGCCCGATGCCATCATTGTGATTGGGGAGGGGGCGCAGATGGGCATC
AACGAGTGCCAGTACCAGTTCCGCTTCGGACGCTGGAACTGCTCTGCCCTCGGCGAGAAGACCGTCTTCG
GGCAAGAGCTCCGAGTAGGGAGCCGTGAGGCTGCCTTCACGTACGCCATCACCGCGGCTGGCGTGGCGCA
CGCCGTCACCGCTGCCTGCAGCCAAGGGAACCTGAGCAACTGCGGCTGCGACCGCGAGAAGCAGGGCTAC
TACAACCAAGCCGAGGGCTGGAAGTGGGGCGGCTGCTCGGCCGACGTGCGTTACGGCATCGACTTCTCCC
GGCGCTTCGTGGACGCTCGGGAGATCAAGAAGAACGCGCGGCGCCTCATGAACCTGCATAACAATGAGGC
CGGCAGGAAGGTTCTAGAGGACCGGATGCAGCTGGAGTGCAAGTGCCACGGCGTGTCTGGCTCCTGCACC
ACCAAAACCTGCTGGACCACGCTGCCCAAGTTCCGAGAGGTGGGCCACCTGCTGAAGGAGAAGTACAACG
CGGCCGTGCAGGTGGAGGTGGTGCGGGCCAGCCGTCTGCGGCAGCCCACCTTCCTGCGCATCAAACAGCT
GCGCAGCTATCAGAAGCCCATGGAGACAGACCTGGTGTACATTGAGAAGTCGCCCAACTACTGCGAGGAG
GACGCGGCCACGGGCAGCGTGGGCACGCAGGGCCGTCTCTGCAACCGCACGTCGCCCGGCGCGGACGGCT
GTGACACCATGTGCTGCGGCCGAGGCTACAACACCCACCAGTACACCAAGGTGTGGCAGTGCAACTGCAA
ATTCCACTGGTGCTGCTTCGTCAAGTGCAACACCTGCAGCGAGCGCACCGAGGTCTTCACCTGCAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207691 protein sequence
Red=Cloning site Green=Tags(s)

MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGI
NECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGY
YNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCT
TKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEE
DAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_058238
ORF Size 1047 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_058238.3
RefSeq Size 3928 bp
RefSeq ORF 1050 bp
Locus ID 7477
UniProt ID P56706
Cytogenetics 22q13.31
Protein Families Adult stem cells, Cancer stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway
MW 39.3 kDa
Summary This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_058238" in other vectors (6)
SKU Description Size Price
RC207691L1 Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), Myc-DDK-tagged 10 ug
$757.00
RC207691L2 Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged 10 ug
$757.00
RC207691L3 Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), Myc-DDK-tagged 10 ug
$757.00
RC207691L4 Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged 10 ug
$757.00
RG207691 WNT7B (tGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B) 10 ug
$489.00 $657.00
SC125825 WNT7B (untagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B) 10 ug
$457.00

Plasmid Map for RC207691

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207691
Circular map for RC207691

file-alt Citations

Downregulated miR-329 and miR-410 promote the proliferation and invasion of oral squamous cell carcinoma by targeting Wnt-7b
Shiah, Hsiao, Chang et al
Cancer Res. (2014)
AI Summary: In this study, the Human Wnt-7b expression vector from OriGene was used to investigate the functional role of Wnt-7b in oral squamous cell carcinoma cells, helping to demonstrate how miR-329 and miR-410 regulate cell proliferation and invasion by targeting Wnt-7b.
Snippet: Ambion. Wnt-7b siRNA were purchased from Dharmacon. Human Wnt-7b expression vector was purchased from OriGene. The miRNA over-expression vector pLemiR was obtained from Open-Biosystem. TOP/FOP flash TCF reporter vectors were kindly donated by ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products