WNT7B Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human, Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 36 kDa |
| Gene Name | Wnt family member 7B |
| Database Link | |
| Background | This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat |
| Synonyms | member 7B; wingless-type MMTV integration site family |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Cytokines, Intracellular Proteins, Secreated Proteins |
| Protein Families | Adult stem cells, Cancer stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane |
| Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Lactobacillus GG regulates the Wnt/β-catenin pathway to reinforce intestinal barrier function and alleviate necrotizing enterocolitis
Li, Chen, Sun et al
Journal of Functional Foods (2022) 97, 105243 DOI: 10.1016/j.jff.2022.105243
Li, Chen, Sun et al
Journal of Functional Foods (2022) 97, 105243 DOI: 10.1016/j.jff.2022.105243
Cited by 10
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
