OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SET (NM_003011) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207606
SET (Myc-DDK-tagged)-Human SET nuclear oncogene (SET), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA308954 Rabbit Polyclonal antibody to SET (SET nuclear oncogene)
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SET or NM_003011"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SET
Synonyms 2PP2A; I2PP2A; IGAAD; IPP2A2; MRD58; PHAPII; TAF-I; TAF-IBETA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207606 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGCCGGCGGCCAAAGTCAGTAAAAAGGAGCTCAACTCCAACCACGACGGGGCCGACGAGACCT
CAGAAAAAGAACAGCAAGAAGCGATTGAACACATTGATGAAGTACAAAATGAAATAGACAGACTTAATGA
ACAAGCCAGTGAGGAGATTTTGAAAGTAGAACAGAAATATAACAAACTCCGCCAACCATTTTTTCAGAAG
AGGTCAGAATTGATCGCCAAAATCCCAAATTTTTGGGTAACAACATTTGTCAACCATCCACAAGTGTCTG
CACTGCTTGGGGAGGAAGATGAAGAGGCACTGCATTATTTGACCAGAGTTGAAGTGACAGAATTTGAAGA
TATTAAATCAGGTTACAGAATAGATTTTTATTTTGATGAAAATCCTTACTTTGAAAATAAAGTTCTCTCC
AAAGAATTTCATCTGAATGAGAGTGGTGATCCATCTTCGAAGTCCACCGAAATCAAATGGAAATCTGGAA
AGGATTTGACGAAACGTTCGAGTCAAACGCAGAATAAAGCCAGCAGGAAGAGGCAGCATGAGGAACCAGA
GAGCTTCTTTACCTGGTTTACTGACCATTCTGATGCAGGTGCTGATGAGTTAGGAGAGGTCATCAAAGAT
GATATTTGGCCAAACCCATTACAGTACTACTTGGTTCCCGATATGGATGATGAAGAAGGAGAAGGAGAAG
AAGATGATGATGATGATGAAGAGGAGGAAGGATTAGAAGATATTGACGAAGAAGGGGATGAGGATGAAGG
TGAAGAAGATGAAGATGATGATGAAGGGGAGGAAGGAGAGGAGGATGAAGGAGAAGATGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207606 protein sequence
Red=Cloning site Green=Tags(s)

MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQK
RSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLS
KEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKD
DIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003011
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003011.4
RefSeq Size 2936 bp
RefSeq ORF 834 bp
Locus ID 6418
UniProt ID Q01105, A0A024R895
Cytogenetics 9q34.11
Domains NAP
Protein Families Druggable Genome, Phosphatase, Stem cell - Pluripotency
MW 32.1 kDa
Summary The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003011" in other vectors (6)
SKU Description Size Price
RC207606L1 Lenti ORF clone of Human SET nuclear oncogene (SET), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC207606L2 Lenti ORF clone of Human SET nuclear oncogene (SET), transcript variant 2, mGFP tagged 10 ug
$600.00
RC207606L3 Lenti ORF clone of Human SET nuclear oncogene (SET), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC207606L4 Lenti ORF clone of Human SET nuclear oncogene (SET), transcript variant 2, mGFP tagged 10 ug
$600.00
RG207606 SET (tGFP-tagged) - Human SET nuclear oncogene (SET), transcript variant 2 10 ug
$489.00 $500.00
SC118245 SET (untagged)-Human SET nuclear oncogene (SET), transcript variant 2 10 ug
$300.00

Plasmid Map for RC207606

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207606
Circular map for RC207606

file-alt Citations

Upregulation of the oncoprotein SET determines poor clinical outcomes in hepatocellular carcinoma and shows therapeutic potential
Hung, Chen, Chu et al
Oncogene (2016)
Cited by 53
AI Summary: OriGene’s Anti-DDK-Tag antibody (TA50011) was used in this study to detect DDK-tagged proteins, contributing to the analysis of SET protein expression and function in hepatocellular carcinoma.
Snippet: CA, USA). Anti-DDK-Tag (TA50011) was obtained from Origene (Rockville, MD, USA), anti-PP2Ac (12–219) was from Millipore (Darmstadt, Germany) and anti-SET (A302-262A) from Bethyl (Montgomery, TX, USA). Other antibodies ... Cite SaveSaving
SET antagonist enhances the chemosensitivity of non-small cell lung cancer cells by reactivating protein phosphatase 2A
Hung, Wang, Chen et al
Oncotarget (2016) 7 (1), 638-55 DOI: 10.18632/oncotarget.6313
Cited by 35
AI Summary: OriGene products, specifically the SET shRNA (OriGene, Cat# TL313482) and SET overexpression plasmid (OriGene, Cat# RC200674), were used to manipulate SET expression in NSCLC cells, enabling the study of SET’s role in cell growth, chemoresistance, and response to SET antagonists in this research.
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products