OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta 2 Microglobulin (B2M) (NM_004048) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207587
B2M (Myc-DDK-tagged)-Human beta-2-microglobulin (B2M)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA802776 B2M mouse monoclonal antibody, clone OTI1A9 (formerly 1A9) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "beta 2 Microglobulin or NM_004048"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol beta 2 Microglobulin
Synonyms IMD43
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207587 representing NM_004048
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTA
CTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGT
GTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAG
CATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTG
AAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCG
AGACATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207587 representing NM_004048
Red=Cloning site Green=Tags(s)

MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE
HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004048
ORF Size 357 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004048.4
RefSeq Size 987 bp
RefSeq ORF 360 bp
Locus ID 567
UniProt ID P61769
Cytogenetics 15q21.1
Domains ig, IGc1
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Antigen processing and presentation
MW 13.71 kDa
Summary This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.provided by RefSeq, Aug 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004048" in other vectors (6)
SKU Description Size Price
RC207587L1 Lenti ORF clone of Human beta-2-microglobulin (B2M), Myc-DDK-tagged 10 ug
$450.00
RC207587L2 Lenti ORF clone of Human beta-2-microglobulin (B2M), mGFP tagged 10 ug
$450.00
RC207587L3 Lenti ORF clone of Human beta-2-microglobulin (B2M), Myc-DDK-tagged 10 ug
$450.00
RC207587L4 Lenti ORF clone of Human beta-2-microglobulin (B2M), mGFP tagged 10 ug
$450.00
RG207587 B2M (tGFP-tagged) - Human beta-2-microglobulin (B2M) 10 ug
$489.00
SC117632 B2M (untagged)-Human beta-2-microglobulin (B2M) 10 ug
$150.00

Plasmid Map for RC207587

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207587
Circular map for RC207587

file-alt Citations

A TNFR2-Specific TNF Fusion Protein With Improved In Vivo Activity
Vargas, Wagner, Shaikh et al
Front Immunol (2022) 13, 888274 DOI: 10.3389/fimmu.2022.888274
Cited by 27
AI Summary: OriGene contributed human FcRn (#RC200364), murine FcRn (MG#205688), and beta-2 microglobulin (#RC207587) expression plasmids, which were used in this study to facilitate the analysis of FcRn-mediated serum retention and activity of the TNFR2-specific TNF fusion protein.
Snippet: … Expression plasmids encoding human FcRn (#RC200364), murine FcRn (MG#205688) and beta-2 microglobulin (#RC207587) were obtained from Origene (Rockville, USA). … The caspase inhibitor Z-VAD-FMK was obtained from Thermo Fisher;human FcRn (#RC200364), murine FcRn (MG#205688) and beta-2 microglobulin (#RC207587) were obtained from Origene (Rockville, USA). …
FigureFigureFigure
Development of a label-free FcRn-mediated transcytosis assay for in vitro characterization of FcRn interactions with therapeutic antibodies and Fc-fusion proteins
Chung, Lin, Nguyen et al
J. Immunol. Methods (2018)
AI Summary: OriGene contributed to this study by providing expression vectors encoding the human FcRn heavy chain and human B2M with C-terminal Myc-Flag tags, which were used to generate cell lines essential for developing the FcRn-mediated transcytosis assay.
Snippet: and the cells passaged once weekly. Expression vectors encoding the human FcRn heavy chain and a human B2M with C-terminal Myc-Flag tags were purchased from OriGene (Rockville, MD). MDCK II cells were sequentially
Evidence of activation of the Nrf2 pathway in multiple sclerosis patients treated with delayed-release dimethyl fumarate in the Phase 3 DEFINE and CONFIRM studies
Gopal, Mikulskis, Gold et al
Mult. Scler. (2017)
AI Summary: OriGene products contributed to this study by providing plasmids containing HO1, B2M, and NQO1 cDNA fragments, which were used as standards and controls in the NQO1 assay to assess Nrf2 pathway activation.
Snippet: The NQO1 assay was run as a single-plex reaction. Standards and controls were prepared using plasmids containing HO1, B2M, and NQO1 cDNA fragments (Origene)
Key Residues at Third CDR3β Position Impact Structure and Antigen Recognition of Human Invariant NK TCRs
Chamoto, Guo, Scally et al
J. Immunol. (2016)
AI Summary: OriGene’s β2-microglobulin short hairpin RNA was used to generate TCR transfectants in Jurkat 76 cells, enabling the study of how specific CDR3β residues affect the structure and antigen recognition of human invariant NK TCRs.
Snippet: org/). Generation of TCR transfectants Using the 293GPG-based retrovirus system (30), TCRa 2 b2 Jurkat 76 cells were transduced with ab2-microglobulin short hairpin RNA (Origene, Rock- ville, MD) and the Va24i gene. The ... Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products