OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPR55 (NM_005683) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207570
GPR55 (Myc-DDK-tagged)-Human G protein-coupled receptor 55 (GPR55)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GPR55 or NM_005683"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GPR55
Synonyms LPIR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207570 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCAGCAAAACACCAGTGGGGACTGCCTGTTTGACGGTGTCAACGAGCTGATGAAAACCCTACAGT
TTGCAGTCCACATCCCCACCTTCGTCCTGGGCCTGCTCCTCAACCTGCTGGCCATCCATGGCTTCAGCAC
CTTCCTTAAGAACAGGTGGCCCGATTATGCTGCCACCTCCATCTACATGATCAACCTGGCAGTCTTTGAC
CTGCTGCTGGTGCTCTCCCTCCCATTCAAGATGGTCCTGTCCCAGGTACAGTCCCCCTTCCCGTCCCTGT
GCACCCTGGTGGAGTGCCTTTACTTCGTCAGCATGTACGGAAGCGTCTTCACCATCTGCTTCATCAGCAT
GGACCGGTTCTTGGCCATCCGTTACCCGCTACTGGTGAGCCACCTCCGGTCCCCCAGGAAGATCTTTGGG
ATCTGCTGCACCATCTGGGTCCTGGTGTGGACCGGAAGCATCCCTATCTACAGTTTCCATGGGAAAGTGG
AAAAATACATGTGCTTCCACAACATGTCTGATGATACCTGGAGCGCCAAGGTCTTCTTCCCGCTGGAGGT
GTTTGGCTTCCTCCTTCCCATGGGCATCATGGGCTTCTGCTGCTCCAGGAGCATCCACATCCTGCTGGGC
CGCCGAGACCACACCCAGGACTGGGTGCAGCAGAAAGCCTGCATCTACAGCATCGCAGCCAGCCTGGCTG
TCTTCGTGGTCTCCTTCCTCCCAGTCCACCTGGGGTTCTTCCTGCAGTTCCTGGTGAGAAACAGCTTTAT
CGTAGAGTGCAGAGCCAAGCAGAGCATCAGCTTCTTCTTGCAATTGTCCATGTGTTTCTCCAACGTCAAC
TGCTGCCTGGATGTTTTCTGCTACTACTTTGTCATCAAAGAATTCCGCATGAACATCAGGGCCCACCGGC
CTTCCAGGGTCCAGCTGGTCCTGCAGGACACCACGATCTCCCGGGGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207570 protein sequence
Red=Cloning site Green=Tags(s)

MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFD
LLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFG
ICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLG
RRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVN
CCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005683
ORF Size 957 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005683.4
RefSeq Size 3828 bp
RefSeq ORF 960 bp
Locus ID 9290
UniProt ID Q9Y2T6
Cytogenetics 2q37.1
Protein Families Druggable Genome, GPCR, Transmembrane
MW 36.6 kDa
Summary This gene belongs to the G-protein-coupled receptor superfamily. The encoded integral membrane protein is a likely cannabinoid receptor. It may be involved in several physiological and pathological processes by activating a variety of signal transduction pathways. provided by RefSeq, Aug 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005683" in other vectors (6)
SKU Description Size Price
RC207570L1 Lenti ORF clone of Human G protein-coupled receptor 55 (GPR55), Myc-DDK-tagged 10 ug
$600.00
RC207570L2 Lenti ORF clone of Human G protein-coupled receptor 55 (GPR55), mGFP tagged 10 ug
$600.00
RC207570L3 Lenti ORF clone of Human G protein-coupled receptor 55 (GPR55), Myc-DDK-tagged 10 ug
$600.00
RC207570L4 Lenti ORF clone of Human G protein-coupled receptor 55 (GPR55), mGFP tagged 10 ug
$600.00
RG207570 GPR55 (tGFP-tagged) - Human G protein-coupled receptor 55 (GPR55) 10 ug
$489.00 $500.00
SC126570 GPR55 (untagged)-Human G protein-coupled receptor 55 (GPR55) 10 ug
$300.00

Plasmid Map for RC207570

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207570
Circular map for RC207570

file-alt Citations

Glycerophosphodiesterase 3 (GDE3) is a lysophosphatidylinositol-specific ecto-phospholipase C acting as an endocannabinoid signaling switch
Briand-Mésange, Pons, Allart et al
J. Biol. Chem. (2020) 295 (46), 15767-15781 DOI: 10.1074/jbc.RA120.015278
AI Summary: In this study, the human GPR55 plasmid (NM_005683.2) from OriGene Technologies was used to investigate the role of GDE3 in endocannabinoid signaling pathways.
Snippet: human GDE3 (NM_017711.3, hGDPD2), murine GDE2 (NM_201352, mGDPD5) and human CB2 (NM_001841 hCNR2) were obtained from ThermoFisher Scientific ABgene (Epsom, Surrey, UK);human GPR55 (NM_005683.2) was from OriGene Technologies (Rockville
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products