OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBFOX2 (NM_001031695) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC206846
RBFOX2 (Myc-DDK-tagged)-Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA345761 Rabbit Polyclonal Anti-RBM9 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RBFOX2 or NM_001031695"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RBFOX2
Synonyms dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206846 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAAAAAGAAAATGGTAACTCAGGGTAACCAGGAGCCGACAACAACTCCTGACGCAATGGTTCAGC
CTTTTACTACCATCCCATTTCCACCACCTCCGCAGAATGGAATTCCCACAGAGTATGGGGTGCCACACAC
TCAAGACTATGCCGGCCAGACCGGTGAGCATAACCTGACACTCTACGGAAGTACGCAAGCCCACGGGGAG
CAGAGCAGCAACTCACCCAGCACACAAAATGGATCTCTTACGACAGAAGGTGGAGCACAGACAGACGGCC
AGCAGTCACAGACACAAAGTAGTGAAAATTCAGAGAGTAAATCTACCCCGAAACGGCTGCATGTCTCTAA
TATTCCTTTCCGCTTCCGGGACCCTGACCTCCGGCAGATGTTTGGGCAGTTTGGCAAAATCCTAGATGTA
GAAATAATCTTTAATGAACGTGGCTCTAAGGGATTCGGGTTCGTAACTTTCGAGAATAGTGCTGATGCAG
ACAGGGCCAGGGAGAAATTACACGGCACCGTGGTAGAGGGCCGTAAAATCGAGGTGAATAATGCTACAGC
ACGTGTAATGACCAATAAGAAGATGGTCACACCATATGCAAATGGTTGGAAATTAAGCCCAGTAGTTGGA
GCTGTATATGGTCCGGAGTTATATGCAGCATCCAGCTTTCAAGCAGATGTGTCCCTAGGCAATGATGCAG
CAGTGCCCCTATCAGGAAGAGGGGGTATCAACACTTACATTCCTTTAATCAGTCTCCCTTTAGTTCCTGG
CTTCCCTTACCCTACTGCAGCCACCACGGCAGCCGCTTTCAGAGGAGCCCATTTGAGGGGCAGAGGGCGG
ACAGTATATGGTGCAGTCCGAGCGGTACCTCCAACAGCCATCCCCGCCTATCCAGGTGTGGTTTACCAGG
ACGGATTTTACGGTGCTGACCTCTATGGTGGATATGCAGCCTACAGATATGCACAGCCTGCTACTGCAAC
CGCAGCCACCGCTGCTGCAGCCGCTGCAGCCGCTTACAGTGACGGTTATGGCAGGGTGTACACAGCCGAC
CCCTACCATGCCCTTGCCCCTGCCGCTAGCTATGGAGTTGGCGCTGTGGCGAGTTTATACCGAGGTGGCT
ACAGCCGATTTGCCCCCTAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206846 protein sequence
Red=Cloning site Green=Tags(s)

MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE
QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV
EIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG
AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR
TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
PYHALAPAASYGVGAVASLYRGGYSRFAPY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001031695
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001031695.4
RefSeq Size 6997 bp
RefSeq ORF 1143 bp
Locus ID 23543
UniProt ID O43251
Cytogenetics 22q12.3
Protein Families Druggable Genome, Transcription Factors
MW 40.4 kDa
Summary This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001031695" in other vectors (7)
SKU Description Size Price
RC206846L1 Lenti ORF clone of Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC206846L2 Lenti ORF clone of Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1, mGFP tagged 10 ug
$757.00
RC206846L3 Lenti ORF clone of Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC206846L4 Lenti ORF clone of Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG206846 RBFOX2 (tGFP-tagged) - Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1 10 ug
$489.00 $657.00
SC302541 RBFOX2 (untagged)-Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1 10 ug
$503.00
SC320568 RBFOX2 (untagged)-Human RNA binding protein, fox-1 homolog (C. elegans) 2 (RBFOX2), transcript variant 1 10 ug
$457.00

Plasmid Map for RC206846

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC206846
Circular map for RC206846

file-alt Citations

Rebalancing NTRK2 isoforms promotes vascular regeneration in bronchopulmonary dysplasia
Zhang, Tan, Liu et al
Cell Stem Cell (2026) 33 (1), 125-141.e11 DOI: 10.1016/j.stem.2025.12.006
Cited by 6
AI Summary: OriGene’s HOXA5 (NM_019102) Human Tagged ORF Clone (RG202156) and RBFOX2 (NM_001031695) Human Tagged ORF Clone (RC206846) were used in this study to investigate the molecular mechanisms underlying endothelial dysfunction and isoform switching in bronchopulmonary dysplasia.
Snippet: HOXA5 (NM_019102) Human Tagged ORF Clone Origene RG202156 RBFOX2 (NM_001031695) Human Tagged ORF Clone Origene RC206846
RBFOX2 deregulation promotes pancreatic cancer progression and metastasis through alternative splicing
Maurin, Ranjouri, Megino-Luque et al
Nat Commun (2023) 14 (1), 8444 DOI: 10.1038/s41467-023-44126-w
Cited by 51
AI Summary: OriGene products contributed to this study by providing DDK-MYC tagged RBFOX2 cDNAs (Cat. nos. RC206846 for RBFOX2-V1 and RC222907 for RBFOX2-V4) and the pLenti vector (Cat. no. PS100092), which were used to investigate the role of RBFOX2 in pancreatic cancer progression through alternative splicing.
Snippet: As against RBFOX2 were designed using splashRNA 75 and cloned into the lentiviral PRRL vector as described 76. See Supplemental Table 1 for sequences. DDK-MYC tagged RBFOX2 cDNAs were purchased from Origene in pCMV6-Entry vector (Cat. nos. RC206846 for RBFOX2-V1 and RC222907 for RBFOX2-V4). cDNAs were first subcloned into pLenti (Origene Cat. no. PS100092) maintaining the DDK-MYC tag and then int
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products