OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Asialoglycoprotein Receptor 1 (ASGR1) (NM_001671) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205686
ASGR1 (Myc-DDK-tagged)-Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
TA591068 Rabbit monoclonal anti-ASGR1, clone OTIR1H6
100 ul
$519.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Asialoglycoprotein Receptor 1 or NM_001671"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Asialoglycoprotein Receptor 1
Synonyms ASGPR; ASGPR1; CLEC4H1; HL-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205686 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAAGGAGTATCAAGACCTTCAGCATCTGGACAATGAGGAGAGTGACCACCATCAGCTCAGAAAAG
GGCCACCTCCTCCCCAGCCCCTCCTGCAGCGTCTCTGCTCCGGACCTCGCCTCCTCCTGCTCTCCCTGGG
CCTCAGCCTCCTGCTGCTTGTGGTTGTCTGTGTGATCGGATCCCAAAACTCCCAGCTGCAGGAGGAGCTG
CGGGGCCTGAGAGAGACGTTCAGCAACTTCACAGCGAGCACGGAGGCCCAGGTCAAGGGCTTGAGCACCC
AGGGAGGCAATGTGGGAAGAAAGATGAAGTCGCTAGAGTCCCAGCTGGAGAAACAGCAGAAGGACCTGAG
TGAAGATCACTCCAGCCTGCTGCTCCACGTGAAGCAGTTCGTGTCTGACCTGCGGAGCCTGAGCTGTCAG
ATGGCGGCGCTCCAGGGCAATGGCTCAGAAAGGACCTGCTGCCCGGTCAACTGGGTGGAGCACGAGCGCA
GCTGCTACTGGTTCTCTCGCTCCGGGAAGGCCTGGGCTGACGCCGACAACTACTGCCGGCTGGAGGACGC
GCACCTGGTGGTGGTCACGTCCTGGGAGGAGCAGAAATTTGTCCAGCACCACATAGGCCCTGTGAACACC
TGGATGGGCCTCCACGACCAAAACGGGCCCTGGAAGTGGGTGGACGGGACGGACTACGAGACGGGCTTCA
AGAACTGGAGGCCGGAGCAGCCGGACGACTGGTACGGCCACGGGCTCGGAGGAGGCGAGGACTGTGCCCA
CTTCACCGACGACGGCCGCTGGAACGACGACGTCTGCCAGAGGCCCTACCGCTGGGTCTGCGAGACAGAG
CTGGACAAGGCCAGCCAGGAGCCACCTCTCCTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205686 protein sequence
Red=Cloning site Green=Tags(s)

MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEEL
RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQ
MAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNT
WMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETE
LDKASQEPPLL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001671
ORF Size 873 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001671.5
RefSeq Size 1519 bp
RefSeq ORF 876 bp
Locus ID 432
UniProt ID P07306
Cytogenetics 17p13.1
Domains CLECT, lectin_N
Protein Families Druggable Genome, Transmembrane
MW 33.2 kDa
Summary This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jan 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001671" in other vectors (6)
SKU Description Size Price
RC205686L1 Lenti ORF clone of Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205686L2 Lenti ORF clone of Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC205686L3 Lenti ORF clone of Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205686L4 Lenti ORF clone of Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG205686 ASGR1 (tGFP-tagged) - Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1 10 ug
$489.00 $500.00
SC319563 ASGR1 (untagged)-Human asialoglycoprotein receptor 1 (ASGR1), transcript variant 1 10 ug
$300.00

Plasmid Map for RC205686

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205686
Circular map for RC205686

file-alt Citations

Cholesterol Localization Around the Metabotropic Glutamate Receptor 2
Kurth, Lolicato, Sandoval-Perez et al
J Phys Chem B (2020) 124 (41), 9061-9078 DOI: 10.1021/acs.jpcb.0c05264
Cited by 20
AI Summary: OriGene products contributed to this study by providing the pCMV6_GRM2_MycFlag plasmid (RC218103) for expressing tagged mGluR2 constructs and the Asialoglycoprotein Receptor 1 cDNA clone (RC205686), which were used in biochemical assays to investigate cholesterol interactions with mGluR2.
Snippet: … mGluR2 has been shown to be regulated by its surrounding lipid environment, especially by cholesterol, ...;- The GRM2 constructs carrying either a Myc- or a Flag-tag at the C-terminal end were cloned from the pCMV6_GRM2_MycFlag RC218103 plasmid (OriGene, Rockville, USA) ASGRI was obtained as cDNA clone from Origene as Asialoglycoprotein Receptor 1 RC205686
Inhibition of Ebola virus glycoprotein-mediated cytotoxicity by targeting its transmembrane domain and cholesterol
Hacke, Björkholm, Hellwig et al
Nat Commun (2015) 6, 7688 DOI: 10.1038/ncomms8688
Cited by 51
AI Summary: OriGene contributed to this study by providing the FLAG-tagged ASGR1-cDNA (clone # RC205686), which was used to investigate the molecular mechanisms underlying Ebola virus glycoprotein-mediated cytotoxicity.
Snippet: Site-directed mutagenesis was performed using the QuikChange Site-Directed Mutagenesis Kit (Stratagene). FLAG-tagged ASGR1-cDNA was obtained from Origene (clone # RC205686)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products