OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAG2 (NM_000536) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205065
RAG2 (Myc-DDK-tagged)-Human recombination activating gene 2 (RAG2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $491.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA307957 Rabbit polyclonal antibody to RAG2 (recombination activating gene 2)
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RAG2 or NM_000536"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAG2
Synonyms RAG-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205065 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTGCAGATGGTAACAGTCAGTAATAACATAGCCTTAATTCAGCCAGGCTTCTCACTGATGAATT
TTGATGGACAAGTTTTCTTCTTTGGACAAAAAGGCTGGCCCAAAAGATCCTGCCCCACTGGAGTTTTCCA
TCTGGATGTAAAGCATAACCATGTCAAACTGAAGCCTACAATTTTCTCTAAGGATTCCTGCTACCTCCCT
CCTCTTCGCTACCCAGCCACTTGCACATTCAAAGGCAGCTTGGAGTCTGAAAAGCATCAATACATCATCC
ATGGAGGGAAAACACCAAACAATGAGGTTTCAGATAAGATTTATGTCATGTCTATTGTTTGCAAGAACAA
CAAAAAGGTTACTTTTCGCTGCACAGAGAAAGACTTGGTAGGAGATGTTCCTGAAGCCAGATATGGTCAT
TCCATTAATGTGGTGTACAGCCGAGGGAAAAGTATGGGTGCTCTCTTTGGAGGACGCTCATACATGCCTT
CTACCCACAGAACCACAGAAAAATGGAATAGTGTAGCTGACTGCCTGCCCTGTGTTTTCCTGGTGGATTT
TGAATTTGGGTGTGCTACATCATACATTCTTCCAGAACTTCAGGATGGGCTATCTTTTCATGTCTCTATT
GCCAAAAATGACACCATCTATATTTTAGGAGGACATTCACTTGCCAATAATATCCGGCCTGCCAACCTGT
ACAGAATAAGGGTTGATCTTCCCCTGGGTAGCCCAGCTGTGAATTGCACAGTCTTGCCAGGAGGAATCTC
TGTCTCCAGTGCAATCCTGACTCAAACTAACAATGATGAATTTGTTATTGTTGGTGGCTATCAGCTTGAA
AATCAAAAAAGAATGATCTGCAACATCATCTCTTTAGAGGACAACAAGATAGAAATTCGTGAGATGGAGA
CCCCAGATTGGACCCCAGACATTAAGCACAGCAAGATATGGTTTGGAAGCAACACGGGAAATGGAACTGT
TTTTCTTGGCATACCAGGAGACAATAAACAAGTTGTTTCAGAAGGATTCTATTTCTATATGTTGAAATGT
GCTGAAGATGATACTAATGAAGAGCAGACAACATTCACAAACAGTCAAACATCAACAGAAGATCCAGGGG
ATTCCACTCCCTTTGAAGACTCTGAAGAATTTTGTTTCAGTGCAGAAGCAAATAGTTTTGATGGTGATGA
TGAATTTGACACCTATAATGAAGATGATGAAGAAGATGAGTCTGAGACAGGCTACTGGATTACATGCTGC
CCTACTTGTGATGTGGATATCAACACTTGGGTACCATTCTATTCAACTGAGCTCAACAAACCCGCCATGA
TCTACTGCTCTCATGGGGATGGGCACTGGGTCCATGCTCAGTGCATGGATCTGGCAGAACGCACACTCAT
CCATCTGTCAGCAGGAAGCAACAAGTATTACTGCAATGAGCATGTGGAGATAGCAAGAGCTCTACACACT
CCCCAAAGAGTCCTACCCTTAAAAAAGCCTCCAATGAAATCCCTCCGTAAAAAAGGTTCTGGAAAAATCT
TGACTCCTGCCAAGAAATCCTTTCTTAGAAGGTTGTTTGAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205065 protein sequence
Red=Cloning site Green=Tags(s)

MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPTIFSKDSCYLP
PLRYPATCTFKGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGH
SINVVYSRGKSMGALFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPELQDGLSFHVSI
AKNDTIYILGGHSLANNIRPANLYRIRVDLPLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE
NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGSNTGNGTVFLGIPGDNKQVVSEGFYFYMLKC
AEDDTNEEQTTFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGYWITCC
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARALHT
PQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000536
ORF Size 1581 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000536.1, NP_000527.1
RefSeq Size 2457 bp
RefSeq ORF 1584 bp
Locus ID 5897
UniProt ID P55895
Cytogenetics 11p12
Protein Families Druggable Genome
Protein Pathways Primary immunodeficiency
MW 59.2 kDa
Summary This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000536" in other vectors (6)
SKU Description Size Price
RC205065L1 Lenti ORF clone of Human recombination activating gene 2 (RAG2), transcript variant 1, Myc-DDK-tagged 10 ug
$791.00
RC205065L2 Lenti ORF clone of Human recombination activating gene 2 (RAG2), transcript variant 1, mGFP tagged 10 ug
$791.00
RC205065L3 Lenti ORF clone of Human recombination activating gene 2 (RAG2), transcript variant 1, Myc-DDK-tagged 10 ug
$791.00
RC205065L4 Lenti ORF clone of Human recombination activating gene 2 (RAG2), transcript variant 1, mGFP tagged 10 ug
$791.00
RG205065 RAG2 (tGFP-tagged) - Human recombination activating gene 2 (RAG2), transcript variant 1 10 ug
$489.00 $691.00
SC122564 RAG2 (untagged)-Human recombination activating gene 2 (RAG2), transcript variant 1 10 ug
$492.00

Plasmid Map for RC205065

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205065
Circular map for RC205065

file-alt Citations

Inhibition of non-homologous end joining in Fanconi Anemia cells results in rescue of survival after interstrand crosslinks but sensitization to replication associated double-strand breaks
Eccles, Bell, Powell
DNA Repair (Amst.) (2018) 64, 1-9 DOI: 10.1016/j.dnarep.2018.02.003
AI Summary: OriGene’s CMV6-RAG1 and CMV6-RAG2 plasmids were used to express RAG1 and RAG2 proteins in HEK293T cells, enabling the study of V(D)J recombination and NHEJ pathway activity in the context of Fanconi Anemia protein depletion.
Snippet: 2 × 10 6 HEK293T cells were transiently transfected with 4 μg NT, FANCD2 or FANCG siRNA. After 24 h, cells were transfected with 2 μg each CMV6-RAG1 (Origene), CMV6-RAG2 (Origene), and pSVD3-320, in addition to 1 μg siRNA using Lipofectamine 2000
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products