OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JUNB (NM_002229) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203595
JUNB (Myc-DDK-tagged)-Human jun B proto-oncogene (JUNB)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "JUNB or NM_002229"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol JUNB
Synonyms AP-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203595 representing NM_002229
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATT
CGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC

ATGTGCACTAAAATGGAACAGCCCTTCTACCACGACGACTCATACACAGCTACGGGATAC
GGCCGGGCCCCTGGTGGCCTCTCTCTACACGACTACAAACTCCTGAAACCGAGCCTGGCG
GTCAACCTGGCCGACCCCTACCGGAGTCTCAAAGCGCCTGGGGCTCGCGGACCCGGCCCA
GAGGGCGGCGGTGGCGGCAGCTACTTTTCTGGTCAGGGCTCGGACACCGGCGCGTCTCTC
AAGCTCGCCTCTTCGGAGCTGGAACGCCTGATTGTCCCCAACAGCAACGGCGTGATCACG
ACGACGCCTACACCCCCGGGACAGTACTTTTACCCCCGCGGGGGTGGCAGCGGTGGAGGT
GCAGGGGGCGCAGGGGGCGGCGTCACCGAGGAGCAGGAGGGCTTCGCCGACGGCTTTGTC
AAAGCCCTGGACGATCTGCACAAGATGAACCACGTGACACCCCCCAACGTGTCCCTGGGC
GCTACCGGGGGGCCCCCGGCTGGGCCCGGGGGCGTCTACGCCGGCCCGGAGCCACCTCCC
GTTTACACCAACCTCAGCAGCTACTCCCCAGCCTCTGCGTCCTCGGGAGGCGCCGGGGCT
GCCGTCGGGACCGGGAGCTCGTACCCGACGACCACCATCAGCTACCTCCCACACGCGCCG
CCCTTCGCCGGTGGCCACCCGGCGCAGCTGGGCTTGGGCCGCGGCGCCTCCACCTTCAAG
GAGGAACCGCAGACCGTGCCGGAGGCGCGCAGCCGGGACGCCACGCCGCCGGTGTCCCCC
ATCAACATGGAAGACCAAGAGCGCATCAAAGTGGAGCGCAAGCGGCTGCGGAACCGGCTG
GCGGCCACCAAGTGCCGGAAGCGGAAGCTGGAGCGCATCGCGCGCCTGGAGGACAAGGTG
AAGACGCTCAAGGCCGAGAACGCGGGGCTGTCGAGTACCGCCGGCCTCCTCCGGGAGCAG
GTGGCCCAGCTCAAACAGAAGGTCATGACCCACGTCAGCAACGGCTGTCAGCTGCTGCTT
GGGGTCAAGGGACACGCCTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGAT
GACGACGATAAGGTTTAAA
Protein Sequence
>RC203595 protein sequence
Blue=ORF Red=Cloning site Green=Tag(s)

MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002229
ORF Size 1041 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002229.1
RefSeq Size 1832 bp
RefSeq ORF 1044 bp
Locus ID 3726
UniProt ID P17275, Q5U079
Cytogenetics 19p13.13
Domains BRLZ, Jun
Protein Families Druggable Genome, Transcription Factors
MW 35.9 kDa
Summary Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGACGTCA-3'.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002229" in other vectors (6)
SKU Description Size Price
RC203595L1 Lenti ORF clone of Human jun B proto-oncogene (JUNB), Myc-DDK-tagged 10 ug
$757.00
RC203595L2 Lenti ORF clone of Human jun B proto-oncogene (JUNB), mGFP tagged 10 ug
$757.00
RC203595L3 Lenti ORF clone of Human jun B proto-oncogene (JUNB), Myc-DDK-tagged 10 ug
$757.00
RC203595L4 Lenti ORF clone of Human jun B proto-oncogene (JUNB), mGFP tagged 10 ug
$757.00
RG203595 JUNB (tGFP-tagged) - Human jun B proto-oncogene (JUNB) 10 ug
$489.00 $657.00
SC118763 JUNB (untagged)-Human jun B proto-oncogene (JUNB) 10 ug
$457.00

Plasmid Map for RC203595

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203595
Circular map for RC203595

file-alt Citations

Calcium-Inducible MAPK/AP-1 Signaling Drives Semaphorin 3A Expression in Normal Human Epidermal Keratinocytes
Kamata, Tominaga, Umehara et al
J. Invest. Dermatol. (2020) 140 (7), 1346-1354.e5 DOI: 10.1016/j.jid.2020.01.001
Cited by 26
AI Summary: OriGene products pCMV6-Entry-JunB (Myc-DDK-tagged), pCMV6-Entry-Fra2 (Myc-DDK-tagged), and pCMV6-Entry were used for the overexpression of transcription factors to investigate their effects on Sema3A expression in human epidermal keratinocytes.
Snippet: Overexpression of candidate transcriptional factors. To examine the overexpression of transcription factors on Sema3A expression, we used pCMV6-Entry-JunB (Myc-DDK-tagged), pCMV6-Entry-Fra2 (Myc-DDK-tagged), and pCMV6-Entry (ORIGENE, Rockville, MD)
The ubiquitin-like modifier FAT10 interferes with SUMO activation
Aichem, Sailer, Ryu et al
Nat Commun (2019) 10 (1), 4452 DOI: 10.1038/s41467-019-12430-z
AI Summary: In this study, the OriGene pCMV-myc-DDK-JunB (JunB-FLAG) plasmid was used to transiently express JunB variants in HEK293 cells, facilitating the investigation of FAT10's interference with SUMO activation and conjugation.
Snippet: open new avenues for the development of anti-cancer therapies. Go to: METHODS PLASMIDS Plasmids used for transient expression of JunB variants in HEK293 cells were pCMV-myc-DDK-JunB (JunB-FLAG) (Origene), pcDNA3-JunB-HA, pcDNA3-JunB-HA-K237R, pcDNA3-JunB-HA-K267R, pcDNA3-JunB-HA-K301R, and pcDNA3-JunB-HA-K3R (11, kindly provided by Dr. Marc Piechaczyk, Montpellier). For expression of FAT10 va
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products