OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPSB4 (NM_080862) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203566
SPSB4 (Myc-DDK-tagged)-Human splA/ryanodine receptor domain and SOCS box containing 4 (SPSB4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SPSB4 or NM_080862"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPSB4
Synonyms SSB-4; SSB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203566 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCAGAAGCTCTCGGGGAGCCTCAAGTCAGTGGAGGTGCGAGAGCCGGCGCTGCGGCCGGCCAAGC
GGGAGCTGCGGGGTGCAGAGCCCGGGCGGCCGGCGCGGCTGGACCAGCTGTTGGACATGCCAGCGGCGGG
GCTGGCTGTGCAGCTGCGGCACGCGTGGAACCCCGAGGACCGCTCGCTCAACGTCTTCGTCAAGGACGAC
GACCGGCTCACCTTCCACCGGCACCCCGTGGCCCAGAGCACCGACGGCATCCGCGGCAAGGTGGGCCACG
CCCGCGGCCTGCACGCCTGGCAGATCAACTGGCCGGCTCGGCAGCGCGGCACCCACGCTGTAGTTGGTGT
GGCCACGGCCCGTGCTCCCCTGCACTCCGTGGGCTACACGGCGCTGGTAGGCAGTGACGCCGAGTCGTGG
GGCTGGGACCTGGGCCGCAGCCGCCTCTACCACGACGGCAAGAACCAGCCCGGCGTGGCCTACCCGGCCT
TTCTGGGGCCCGACGAGGCCTTTGCGCTGCCCGACTCGCTGCTCGTGGTGCTGGACATGGATGAGGGCAC
ACTCAGCTTCATCGTGGATGGCCAGTACCTGGGCGTGGCCTTCCGAGGTCTCAAGGGCAAGAAGCTGTAC
CCGGTGGTGAGTGCCGTGTGGGGCCACTGTGAAGTCACCATGCGCTACATCAACGGCCTTGACCCCGAGC
CCCTGCCACTGATGGACCTGTGCCGGAGATCCATCCGCTCGGCCCTGGGCCGCCAGCGCCTGCAGGACAT
CAGCTCCCTGCCCCTGCCTCAGTCTCTCAAAAACTATCTGCAGTACCAG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203566 protein sequence
Red=Cloning site Green=Tags(s)

MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDD
DRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESW
GWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLY
PVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_080862
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080862.3
RefSeq Size 2455 bp
RefSeq ORF 822 bp
Locus ID 92369
UniProt ID Q96A44
Cytogenetics 3q23
Domains SPRY
Protein Families Druggable Genome
MW 30.2 kDa
Summary Substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:21199876, PubMed:15601820). Negatively regulates nitric oxide (NO) production and limits cellular toxicity in activated macrophages by mediating the ubiquitination and proteasomal degradation of NOS2 (PubMed:21199876). Acts as a bridge which links NOS2 with the ECS E3 ubiquitin ligase complex components ELOC and CUL5 (PubMed:21199876). Diminishes EphB2-dependent cell repulsive responses by mediating the ubiquitination and degradation of EphB2/CTF2 (PubMed:28931592). Regulates cellular clock function by mediating the ubiquitin/proteasome-dependent degradation of the circadian transcriptional repressor NR1D1 (PubMed:26392558).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_080862" in other vectors (4)
SKU Description Size Price
RC203566L3 Lenti ORF clone of Human splA/ryanodine receptor domain and SOCS box containing 4 (SPSB4), Myc-DDK-tagged 10 ug
$600.00
RC203566L4 Lenti ORF clone of Human splA/ryanodine receptor domain and SOCS box containing 4 (SPSB4), mGFP tagged 10 ug
$600.00
RG203566 SPSB4 (tGFP-tagged) - Human splA/ryanodine receptor domain and SOCS box containing 4 (SPSB4) 10 ug
$500.00
SC120350 SPSB4 (untagged)-Human splA/ryanodine receptor domain and SOCS box containing 4 (SPSB4) 10 ug
$300.00

Plasmid Map for RC203566

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203566
Circular map for RC203566

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products