OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UFM1 (NM_016617) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202665
UFM1 (Myc-DDK-tagged)-Human ubiquitin-fold modifier 1 (UFM1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365478 UFM1 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "UFM1 or NM_016617"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UFM1
Synonyms BM-002; C13orf20; HLD14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202665 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGAAGGTTTCCTTTAAGATCACGCTGACGTCGGACCCACGGCTGCCGTACAAAGTACTCAGTGTTC
CTGAAAGTACACCTTTCACAGCAGTCTTAAAGTTTGCAGCAGAAGAATTTAAAGTTCCTGCTGCAACAAG
TGCAATTATTACCAATGATGGAATAGGAATAAATCCTGCACAGACTGCTGGAAATGTTTTTCTAAAACAT
GGTTCAGAACTGCGGATTATTCCTAGAGATCGTGTTGGAAGTTGT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202665 protein sequence
Red=Cloning site Green=Tags(s)

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH
GSELRIIPRDRVGSC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016617
ORF Size 255 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016617.4
RefSeq Size 2636 bp
RefSeq ORF 258 bp
Locus ID 51569
UniProt ID P61960
Cytogenetics 13q13.3
Domains UPF0185
MW 9.1 kDa
Summary UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 PubMed 15071506).supplied by OMIM, Dec 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016617" in other vectors (6)
SKU Description Size Price
RC202665L1 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), Myc-DDK-tagged 10 ug
$450.00
RC202665L2 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), mGFP tagged 10 ug
$450.00
RC202665L3 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), Myc-DDK-tagged 10 ug
$450.00
RC202665L4 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), mGFP tagged 10 ug
$450.00
RG202665 UFM1 (tGFP-tagged) - Human ubiquitin-fold modifier 1 (UFM1) 10 ug
$489.00
SC114161 UFM1 (untagged)-Human ubiquitin-fold modifier 1 (UFM1) 10 ug
$150.00

Plasmid Map for RC202665

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202665
Circular map for RC202665

file-alt Citations

UFMylation of RPL26 links translocation-associated quality control to endoplasmic reticulum protein homeostasis
Wang, Xu, Rogers et al
Cell Res. (2019) 30 (1), 5-20 DOI: 10.1038/s41422-019-0236-6
AI Summary: OriGene's human UFM1 cDNA clone was used to generate UFM1-expressing plasmids, enabling the study of UFM1's role in ribosome UFMylation and ER protein quality control in this research.
Snippet: … While there has been substantial progress in understanding how ERAD eliminates defective polypeptides;To construct UFM1-expressing plasmids, UFM1 cDNA was PCR-amplified from a human UFM1 cDNA clone (Origene) and inserted into pRK5 vector to generate both untagged or N-terminally HA-tagged version. The pcDNA6-FLAG-SBP-UFM1 constructs were generated by inserting DNA fragment encoding FLAG-SBP (Streptavidin-Binding
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products