UFM1 (NM_016617) Human Tagged ORF Clone

SKU
RG202665
UFM1 (tGFP-tagged) - Human ubiquitin-fold modifier 1 (UFM1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UFM1
Synonyms BM-002; C13orf20; HLD14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202665 representing NM_016617
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGAAGGTTTCCTTTAAGATCACGCTGACGTCGGACCCACGGCTGCCGTACAAAGTACTCAGTGTTC
CTGAAAGTACACCTTTCACAGCAGTCTTAAAGTTTGCAGCAGAAGAATTTAAAGTTCCTGCTGCAACAAG
TGCAATTATTACCAATGATGGAATAGGAATAAATCCTGCACAGACTGCTGGAAATGTTTTTCTAAAACAT
GGTTCAGAACTGCGGATTATTCCTAGAGATCGTGTTGGAAGTTGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202665 representing NM_016617
Red=Cloning site Green=Tags(s)

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH
GSELRIIPRDRVGSC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016617
ORF Size 255 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016617.4
RefSeq Size 2529 bp
RefSeq ORF 258 bp
Locus ID 51569
UniProt ID P61960
Cytogenetics 13q13.3
Domains UPF0185
Summary UFM1 is a ubiquitin-like protein that is conjugated to target proteins by E1-like activating enzyme UBA5 (UBE1DC1; MIM 610552) and E2-like conjugating enzyme UFC1 (MIM 610554) in a manner analogous to ubiquitylation (see UBE2M; MIM 603173) (Komatsu et al., 2004 [PubMed 15071506]).[supplied by OMIM, Dec 2008]
Write Your Own Review
You're reviewing:UFM1 (NM_016617) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202665 UFM1 (Myc-DDK-tagged)-Human ubiquitin-fold modifier 1 (UFM1) 10 ug
$150.00
RC202665L1 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), Myc-DDK-tagged 10 ug
$450.00
RC202665L2 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), mGFP tagged 10 ug
$450.00
RC202665L3 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), Myc-DDK-tagged 10 ug
$450.00
RC202665L4 Lenti ORF clone of Human ubiquitin-fold modifier 1 (UFM1), mGFP tagged 10 ug
$450.00
SC114161 UFM1 (untagged)-Human ubiquitin-fold modifier 1 (UFM1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.