OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WNT6 (NM_006522) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202575
WNT6 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 6 (WNT6)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA317519 WNT6 Rabbit Polyclonal (Internal) Antibody
50 ug
$550.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "WNT6 or NM_006522"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WNT6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202575 representing NM_006522
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCGCCCTTACCCTCCCGCCTCGGGCTGCTGCTGCTGCTGCTCCTGTGCCCGGCGCACGTCGGCG
GACTGTGGTGGGCTGTGGGCAGCCCCTTGGTTATGGACCCTACCAGCATCTGCAGGAAGGCACGGCGGCT
GGCCGGGCGGCAGGCCGAGTTGTGCCAGGCTGAGCCGGAAGTGGTGGCAGAGCTAGCTCGGGGCGCCCGG
CTCGGGGTGCGAGAGTGCCAGTTCCAGTTCCGCTTCCGCCGCTGGAATTGCTCCAGCCACAGCAAGGCCT
TTGGACGCATCCTGCAACAGGACATTCGGGAGACGGCCTTCGTGTTCGCCATCACTGCGGCCGGCGCCAG
CCACGCCGTCACGCAGGCCTGTTCTATGGGCGAGCTGCTGCAGTGCGGCTGCCAGGCGCCCCGCGGGCGG
GCCCCTCCCCGGCCCTCCGGCCTGCCCGGCACCCCCGGACCCCCTGGCCCCGCGGGCTCCCCGGAAGGCA
GCGCCGCCTGGGAGTGGGGAGGCTGCGGCGACGACGTGGACTTCGGGGACGAGAAGTCGAGGCTCTTTAT
GGACGCACGGCACAAGCGGGGACGCGGAGACATCCGCGCGTTGGTGCAACTGCACAACAACGAGGCGGGC
AGGCTGGCCGTGCGGAGCCACACGCGCACCGAGTGCAAATGCCACGGGCTGTCGGGATCATGCGCGCTGC
GCACCTGCTGGCAGAAGCTGCCTCCATTTCGCGAGGTGGGCGCGCGGCTGCTGGAGCGCTTCCACGGCGC
CTCACGCGTCATGGGCACCAACGACGGCAAGGCCCTGCTGCCCGCCGTCCGCACGCTCAAGCCGCCGGGC
CGAGCGGACCTCCTCTACGCCGCCGATTCGCCCGACTTCTGCGCCCCCAACCGACGCACCGGCTCCCCCG
GCACGCGCGGTCGCGCCTGCAATAGCAGCGCCCCGGACCTCAGCGGCTGCGACCTGCTGTGCTGCGGCCG
CGGGCACCGCCAGGAGAGCGTGCAGCTCGAAGAGAACTGCCTGTGCCGCTTCCACTGGTGCTGCGTAGTA
CAGTGCCACCGCTGCCGTGTGCGCAAGGAGCTCAGCCTCTGCCTG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202575 representing NM_006522
Red=Cloning site Green=Tags(s)

MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGAR
LGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGR
APPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAG
RLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPG
RADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVV
QCHRCRVRKELSLCL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_006522
ORF Size 1095 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006522.1
RefSeq Size 1700 bp
RefSeq ORF 1098 bp
Locus ID 7475
UniProt ID Q9Y6F9, Q8N2E5
Cytogenetics 2q35
Domains wnt
Protein Families Adult stem cells, Cancer stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway
MW 39.72 kDa
Summary The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006522" in other vectors (6)
SKU Description Size Price
RC202575L1 Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), Myc-DDK-tagged 10 ug
$757.00
RC202575L2 Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), mGFP tagged 10 ug
$757.00
RC202575L3 Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), Myc-DDK-tagged 10 ug
$757.00
RC202575L4 Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), mGFP tagged 10 ug
$757.00
RG202575 WNT6 (tGFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6) 10 ug
$489.00 $657.00
SC103558 WNT6 (untagged)-Human wingless-type MMTV integration site family, member 6 (WNT6) 10 ug
$457.00

Plasmid Map for RC202575

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202575
Circular map for RC202575

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products