OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LYAR (NM_017816) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201908
LYAR (Myc-DDK-tagged)-Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA370881 LYAR rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "LYAR or NM_017816"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYAR
Synonyms ZC2HC2; ZLYAR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201908 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTATTTTTTACATGCAATGCATGTGGTGAATCAGTGAAGAAAATACAAGTGGAAAAGCATGTGTCTG
TTTGCAGAAACTGTGAATGCCTTTCTTGCATTGACTGCGGTAAAGATTTCTGGGGCGATGACTATAAAAA
CCACGTGAAATGCATAAGTGAAGATCAGAAGTATGGTGGCAAAGGCTATGAAGGTAAAACCCACAAAGGC
GACATCAAACAGCAGGCGTGGATTCAGAAAATTAGTGAATTAATAAAGAGACCCAATGTCAGCCCCAAAG
TGAGAGAACTTTTAGAGCAAATTAGTGCTTTTGACAACGTTCCCAGGAAAAAGGCAAAATTTCAGAATTG
GATGAAGAACAGTTTAAAAGTTCATAATGAATCCATTCTGGACCAGGTGTGGAATATCTTTTCTGAAGCT
TCCAACAGCGAACCAGTCAATAAGGAACAGGATCAACGGCCACTCCACCCAGTGGCAAATCCACATGCAG
AAATCTCCACCAAGGTTCCAGCCTCCAAAGTGAAAGACGCCGTGGAACAGCAAGGGGAGGTGAAGAAGAA
TAAAAGAGAAAGAAAGGAAGAACGGCAGAAGAAAAGGAAAAGAGAAAAGAAAGAACTAAAGTTAGAAAAC
CACCAGGAAAACTCAAGGAATCAGAAGCCTAAGAAGCGCAAAAAGGGACAGGAGGCTGACCTTGAGGCTG
GTGGGGAGGAAGTCCCTGAGGCCAATGGCTCTGCAGGGAAGAGGAGCAAGAAGAAGAAGCAGCGCAAGGA
CAGCGCCAGTGAGGAAGAGGCACGCGTGGGCGCAGGGAAGAGGAAGCGGAGGCACTCGGAAGTTGAAACA
GATTCTAAGAAGAAAAAGATGAAGCTCCCAGAGCATCCTGAGGGCGGAGAACCAGAAGACGATGAGGCTC
CTGCAAAAGGTAAATTCAACTGGAAGGGAACTATTAAAGCAATTCTGAAACAGGCCCCAGACAATGAAAT
AACCATCAAAAAGCTAAGGAAAAAGGTTTTAGCTCAGTACTACACAGTGACAGATGAGCATCACAGATCC
GAAGAGGAACTCCTGGTCATCTTTAACAAGAAAATCAGCAAGAACCCTACCTTTAAGTTATTAAAGGACA
AAGTCAAGCTTGTGAAA

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201908 protein sequence
Red=Cloning site Green=Tags(s)

MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKG
DIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEA
SNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLEN
HQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEARVGAGKRKRRHSEVET
DSKKKKMKLPEHPEGGEPEDDEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRS
EEELLVIFNKKISKNPTFKLLKDKVKLVK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_017816
ORF Size 1137 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017816.3
RefSeq Size 1584 bp
RefSeq ORF 1140 bp
Locus ID 55646
UniProt ID Q9NX58
Cytogenetics 4p16.3
MW 43.6 kDa
Summary Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (PubMed:24495227). Also acts at the level of transcription regulation. Along with PRMT5, binds the gamma-globin (HBG1/HBG2) promoter and represses its expression (PubMed:25092918). In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and SNORD41 that encodes a small nucleolar RNA (PubMed:28686580). Preferentially binds to a DNA motif containing 5'-GGTTAT-3' (PubMed:25092918). Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells (By similarity). Prevents nucleolin/NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_017816" in other vectors (7)
SKU Description Size Price
RC201908L1 Lenti ORF clone of Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201908L2 Lenti ORF clone of Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201908L3 Lenti ORF clone of Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201908L4 Lenti ORF clone of Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201908 LYAR (tGFP-tagged) - Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1 10 ug
$657.00
SC113969 LYAR (untagged)-Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1 10 ug
$457.00
SC322377 LYAR (untagged)-Human Ly1 antibody reactive homolog (mouse) (LYAR), transcript variant 1 10 ug
$457.00

Plasmid Map for RC201908

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201908
Circular map for RC201908

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products