OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TFB2M (NM_022366) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201683
TFB2M (Myc-DDK-tagged)-Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA335483 Rabbit Polyclonal Anti-TFB2M Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TFB2M or NM_022366"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TFB2M
Synonyms Hkp1; mtTFB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201683 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGATCCCAGTGGTCGGGCTTCCTCGGCGGCTGAGGCTCTCCGCCTTGGCGGGCGCTGGTCGCTTTT
GCATTTTAGGGTCTGAAGCGGCGACGCGAAAGCATTTGCCGGCGAGGAACCACTGTGGGCTCTCTGACTC
CTCTCCGCAGCTGTGGCCCGAACCGGATTTCAGGAATCCGCCAAGGAAGGCGTCTAAGGCCAGCTTAGAC
TTTAAGCGTTACGTAACCGATCGGAGATTGGCTGAGACCCTGGCGCAAATCTATTTGGGAAAACCAAGTA
GACCTCCACACCTACTGCTGGAGTGCAATCCAGGTCCTGGAATCCTGACTCAGGCATTACTTGAAGCTGG
TGCCAAAGTGGTTGCGCTCGAAAGTGACAAAACTTTTATTCCACATTTGGAGTCCTTAGGAAAAAATCTG
GATGGAAAACTACGAGTGATTCACTGTGACTTCTTTAAACTAGATCCTAGAAGTGGTGGAGTAATAAAAC
CACCTGCTATGTCTTCTCGAGGGCTCTTTAAGAATTTGGGAATAGAAGCAGTTCCTTGGACAGCAGACAT
CCCTTTAAAAGTAGTTGGAATGTTCCCAAGTAGAGGTGAGAAAAGGGCACTTTGGAAACTCGCATATGAC
TTGTATTCCTGTACTTCTATATATAAATTTGGACGAATAGAAGTAAATATGTTTATTGGTGAAAAAGAAT
TCCAGAAACTAATGGCAGATCCTGGAAATCCAGACTTGTATCATGTATTAAGTGTTATCTGGCAATTAGC
TTGTGAGATTAAGGTTCTGCACATGGAGCCTTGGTCATCATTTGATATATACACCCGGAAAGGGCCGCTG
GAAAACCCAAAGCGTAGGGAATTATTAGACCAATTACAACAAAAGCTGTATCTTATTCAAATGATTCCTC
GTCAAAATTTATTTACCAAGAACTTAACACCTATGAACTATAATATATTTTTTCACTTGTTAAAGCACTG
TTTTGGGAGGCGCAGCGCCACTGTAATAGACCACTTACGTTCATTGACTCCACTTGATGCGAGAGATATA
TTGATGCAAATAGGAAAACAGGAGGATGAGAAAGTAGTTAACATGCACCCTCAAGACTTCAAAACACTTT
TTGAAACTATAGAGCGTTCCAAAGATTGTGCTTATAAATGGCTGTATGATGAAACCCTGGAAGATAGG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201683 protein sequence
Red=Cloning site Green=Tags(s)

MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLD
FKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNL
DGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYD
LYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPL
ENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDI
LMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_022366
ORF Size 1188 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022366.3
RefSeq Size 1799 bp
RefSeq ORF 1191 bp
Locus ID 64216
UniProt ID Q9H5Q4
Cytogenetics 1q44
Domains rADc
Protein Families Transcription Factors
MW 45.3 kDa
Summary S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_022366" in other vectors (6)
SKU Description Size Price
RC201683L1 Lenti ORF clone of Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$757.00
RC201683L2 Lenti ORF clone of Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$757.00
RC201683L3 Lenti ORF clone of Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$757.00
RC201683L4 Lenti ORF clone of Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$757.00
RG201683 TFB2M (tGFP-tagged) - Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein 10 ug
$489.00 $657.00
SC112537 TFB2M (untagged)-Human transcription factor B2, mitochondrial (TFB2M), nuclear gene encoding mitochondrial protein 10 ug
$457.00

Plasmid Map for RC201683

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201683
Circular map for RC201683

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products