OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Vimentin (VIM) (NM_003380) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201546
VIM (Myc-DDK-tagged)-Human vimentin (VIM)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA801297 VIM mouse monoclonal antibody, clone OTI1A9 (formerly 1A9) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Vimentin or NM_003380"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Vimentin
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201546 representing NM_003380
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACCAGGTCCGTGTCCTCGTCCTCCTACCGCAGGATGTTCGGCGGCCCGGGCACCGCGAGCCGGC
CGAGCTCCAGCCGGAGCTACGTGACTACGTCCACCCGCACCTACAGCCTGGGCAGCGCGCTGCGCCCCAG
CACCAGCCGCAGCCTCTACGCCTCGTCCCCGGGCGGCGTGTATGCCACGCGCTCCTCTGCCGTGCGCCTG
CGGAGCAGCGTGCCCGGGGTGCGGCTCCTGCAGGACTCGGTGGACTTCTCGCTGGCCGACGCCATCAACA
CCGAGTTCAAGAACACCCGCACCAACGAGAAGGTGGAGCTGCAGGAGCTGAATGACCGCTTCGCCAACTA
CATCGACAAGGTGCGCTTCCTGGAGCAGCAGAATAAGATCCTGCTGGCCGAGCTCGAGCAGCTCAAGGGC
CAAGGCAAGTCGCGCCTGGGGGACCTCTACGAGGAGGAGATGCGGGAGCTGCGCCGGCAGGTGGACCAGC
TAACCAACGACAAAGCCCGCGTCGAGGTGGAGCGCGACAACCTGGCCGAGGACATCATGCGCCTCCGGGA
GAAATTGCAGGAGGAGATGCTTCAGAGAGAGGAAGCCGAAAACACCCTGCAATCTTTCAGACAGGATGTT
GACAATGCGTCTCTGGCACGTCTTGACCTTGAACGCAAAGTGGAATCTTTGCAAGAAGAGATTGCCTTTT
TGAAGAAACTCCACGAAGAGGAAATCCAGGAGCTGCAGGCTCAGATTCAGGAACAGCATGTCCAAATCGA
TGTGGATGTTTCCAAGCCTGACCTCACGGCTGCCCTGCGTGACGTACGTCAGCAATATGAAAGTGTGGCT
GCCAAGAACCTGCAGGAGGCAGAAGAATGGTACAAATCCAAGTTTGCTGACCTCTCTGAGGCTGCCAACC
GGAACAATGACGCCCTGCGCCAGGCAAAGCAGGAGTCCACTGAGTACCGGAGACAGGTGCAGTCCCTCAC
CTGTGAAGTGGATGCCCTTAAAGGAACCAATGAGTCCCTGGAACGCCAGATGCGTGAAATGGAAGAGAAC
TTTGCCGTTGAAGCTGCTAACTACCAAGACACTATTGGCCGCCTGCAGGATGAGATTCAGAATATGAAGG
AGGAAATGGCTCGTCACCTTCGTGAATACCAAGACCTGCTCAATGTTAAGATGGCCCTTGACATTGAGAT
TGCCACCTACAGGAAGCTGCTGGAAGGCGAGGAGAGCAGGATTTCTCTGCCTCTTCCAAACTTTTCCTCC
CTGAACCTGAGGGAAACTAATCTGGATTCACTCCCTCTGGTTGATACCCACTCAAAAAGGACACTTCTGA
TTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTCTCAGCATCACGATGACCTTGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201546 representing NM_003380
Red=Cloning site Green=Tags(s)

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRL
RSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG
QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDV
DNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVA
AKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003380
ORF Size 1398 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003380.5
RefSeq Size 1847 bp
RefSeq ORF 1401 bp
Locus ID 7431
UniProt ID P08670
Cytogenetics 10p13
Domains filament, filament_head
Protein Families ES Cell Differentiation/IPS
MW 53.5 kDa
Summary This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients. provided by RefSeq, Aug 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003380" in other vectors (6)
SKU Description Size Price
RC201546L1 Lenti ORF clone of Human vimentin (VIM), Myc-DDK-tagged 10 ug
$757.00
RC201546L2 Lenti ORF clone of Human vimentin (VIM), mGFP tagged 10 ug
$757.00
RC201546L3 Lenti ORF clone of Human vimentin (VIM), Myc-DDK-tagged 10 ug
$757.00
RC201546L4 Lenti ORF clone of Human vimentin (VIM), mGFP tagged 10 ug
$757.00
RG201546 VIM (tGFP-tagged) - Human vimentin (VIM) 10 ug
$489.00 $657.00
SC111054 VIM (untagged)-Human vimentin (VIM) 10 ug
$457.00

Plasmid Map for RC201546

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201546
Circular map for RC201546

file-alt Citations

RAB7A Regulates Vimentin Phosphorylation through AKT and PAK
Romano, Calcagnile, Margiotta et al
Cancers (Basel) (2021) 13 (9) DOI: 10.3390/cancers13092220
Cited by 24
AI Summary: In this study, OriGene products including the RAB7A cDNA clone (RC206861) and RAB7A shRNA plasmids (TG311337, TG311338) were used to modulate RAB7A expression, enabling the authors to investigate its role in regulating vimentin phosphorylation and kinase activity.
FigureFigureFigure
RAB7A Regulates Vimentin Phosphorylation through AKT and PAK
Romano, Calcagnile, Margiotta et al
Cancers (2021) 13 (9), 2220 DOI: 10.3390/cancers13092220
Cited by 24
AI Summary: OriGene contributed to this study by providing the myc-vimentin plasmid (RC201546), which was used to investigate the interaction between RAB7A and vimentin phosphorylation.
Snippet: The plasmid encoding myc-vimentin was obtained from OriGene (RC201546)
FigureFigureFigure
A vimentin binding small molecule leads to mitotic disruption in mesenchymal cancers
Bollong, Pietilä, Pearson et al
PNAS (2017) 114 (46), E9903-E9912 DOI: 10.1073/pnas.1716009114
Cited by 88
AI Summary: OriGene contributed to this study by providing the VIM-WT-FLAG transient overexpression plasmid (pCMV6-Entry, RC201546), which was used to investigate the effects of the small molecule FiVe1 on vimentin function in mesenchymal cancer cells.
Snippet: The VIM-WT-FLAG transient overexpression plasmid was from Origene [pCMV6-Entry, National Center for Biotechnology Information (NCBI) ref. seq. NM_003380.2, RC201546]
How to Study Intermediate Filaments in Atomic Detail
Chernyatina, Hess, Guzenko et al
Methods Enzymol (2016) 568, 3-33 DOI: 10.1016/bs.mie.2015.09.024
Cited by 17
AI Summary: In this paper, OriGene products such as the pCMV6-Entry vector were used for cloning and expression of intermediate filament protein constructs, enabling structural and functional studies at the atomic level.
Vimentin phosphorylation and assembly are regulated by the small GTPase Rab7a
Cogli, Progida, Bramato et al
Biochim. Biophys. Acta (2013) 1833 (6), 1283-93 DOI: 10.1016/j.bbamcr.2013.02.024
Cited by 71
AI Summary: OriGene’s pCMV6-AN-HA vector (PS100013) was used to express vimentin in this study, enabling the investigation of how Rab7a regulates vimentin phosphorylation and assembly.
Snippet: Vimentin ORF was transferred using AsiSI and MluI restriction enzymes to pCMV6-AN-HA (Origene, PS100013) to obtain a vector for the expression of ... As the onset of CMT2B is in the second-third decade of life and thus development is not affected, these mutant proteins could
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products